KEGG   Streptococcus parauberis: STP_0413Help
Entry
STP_0413          CDS       T01504                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stk  Streptococcus parauberis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STP_0413 (tpiA)
   01230 Biosynthesis of amino acids
    STP_0413 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STP_0413 (tpiA)
   00051 Fructose and mannose metabolism
    STP_0413 (tpiA)
   00562 Inositol phosphate metabolism
    STP_0413 (tpiA)
Enzymes [BR:stk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     STP_0413 (tpiA)
Exosome [BR:stk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   STP_0413 (tpiA)
  Exosomal proteins of bladder cancer cells
   STP_0413 (tpiA)
  Exosomal proteins of melanoma cells
   STP_0413 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
441316..442074
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFIEAVASKLPSSELVEAGIAAPALDLATVLEAAKGSEL
KIAAQNSYFENTGAFTGENSPKVLAEMGTDYVVIGHSERREYFHETDEDINKKAKAIFAN
GLTPIICCGETLETYEEGKAVEFVGAQVSKALAGLSEDQVSSLVIAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQAVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttattgctggtaactggaaaatgaacaaaaatcctgaagaagct
aaagcttttattgaagcagtagcgtctaaattgccttcatcagaattagttgaagctggg
attgcagctcccgcacttgatttagcaacagttcttgaagctgctaaaggttcagaactt
aagattgcagctcaaaattcttattttgaaaatactggtgccttcactggtgaaaatagc
cctaaagtattagctgaaatgggtactgattatgttgttattggacattcagaacgtcgt
gaatatttccacgaaactgacgaagatatcaataaaaaagcaaaagcaatttttgctaac
ggtttgactccgatcatttgttgcggtgaaacactcgaaacttatgaagaaggtaaagca
gttgaatttgtaggtgctcaagtttctaaagcacttgctggcttatctgaagaccaagtt
tcttcacttgttattgcttatgaaccaatctgggctattggaactggtaaatctgcaact
caagatgatgctcaaaatatgtgtaaagcagtgcgtgatgtcgttgcggctgactttggt
caagcagtagcagataaagttcgtgttcaatatggtggttctgttaaacctgaaaacgtt
gcatcatatatggcttgtcctgatgttgatggcgctttagtaggtggagcatcgcttgaa
gcagaaagcttcttagccttacttgattttgtaaaataa

DBGET integrated database retrieval system