KEGG   Streptococcus parauberis: STP_0413Help
Entry
STP_0413          CDS       T01504                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stk  Streptococcus parauberis
Pathway
stk00010  Glycolysis / Gluconeogenesis
stk00051  Fructose and mannose metabolism
stk00562  Inositol phosphate metabolism
stk01100  Metabolic pathways
stk01110  Biosynthesis of secondary metabolites
stk01120  Microbial metabolism in diverse environments
stk01130  Biosynthesis of antibiotics
stk01200  Carbon metabolism
stk01230  Biosynthesis of amino acids
Module
stk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stk_M00002  Glycolysis, core module involving three-carbon compounds
stk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STP_0413 (tpiA)
   00051 Fructose and mannose metabolism
    STP_0413 (tpiA)
   00562 Inositol phosphate metabolism
    STP_0413 (tpiA)
Enzymes [BR:stk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     STP_0413 (tpiA)
Exosome [BR:stk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   STP_0413 (tpiA)
  Exosomal proteins of bladder cancer cells
   STP_0413 (tpiA)
  Exosomal proteins of melanoma cells
   STP_0413 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEF24861
Position
441316..442074
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFIEAVASKLPSSELVEAGIAAPALDLATVLEAAKGSEL
KIAAQNSYFENTGAFTGENSPKVLAEMGTDYVVIGHSERREYFHETDEDINKKAKAIFAN
GLTPIICCGETLETYEEGKAVEFVGAQVSKALAGLSEDQVSSLVIAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQAVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttattgctggtaactggaaaatgaacaaaaatcctgaagaagct
aaagcttttattgaagcagtagcgtctaaattgccttcatcagaattagttgaagctggg
attgcagctcccgcacttgatttagcaacagttcttgaagctgctaaaggttcagaactt
aagattgcagctcaaaattcttattttgaaaatactggtgccttcactggtgaaaatagc
cctaaagtattagctgaaatgggtactgattatgttgttattggacattcagaacgtcgt
gaatatttccacgaaactgacgaagatatcaataaaaaagcaaaagcaatttttgctaac
ggtttgactccgatcatttgttgcggtgaaacactcgaaacttatgaagaaggtaaagca
gttgaatttgtaggtgctcaagtttctaaagcacttgctggcttatctgaagaccaagtt
tcttcacttgttattgcttatgaaccaatctgggctattggaactggtaaatctgcaact
caagatgatgctcaaaatatgtgtaaagcagtgcgtgatgtcgttgcggctgactttggt
caagcagtagcagataaagttcgtgttcaatatggtggttctgttaaacctgaaaacgtt
gcatcatatatggcttgtcctgatgttgatggcgctttagtaggtggagcatcgcttgaa
gcagaaagcttcttagccttacttgattttgtaaaataa

DBGET integrated database retrieval system