KEGG   Streptococcus parauberis: STP_0444Help
Entry
STP_0444          CDS       T01504                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
stk  Streptococcus parauberis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    STP_0444
Enzymes [BR:stk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     STP_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
478019..479803
Genome map
AA seq 594 aa AA seqDB search
MSTFTISDQFYMDGKPFKILSGSIHYFRIPKESWYHSLYNLKALGFNTVETYVPWNYHEA
KEETYNFSDNHDLDFFLSQAQELGLYVLLRPSPYICAEWEFGGLPAWLLTKKVKVRSTDP
NYLFYVNRYYDKLIPILKKHELANGGNIIMHQVENEYGSYGDEKAYLKALKTMMVEKGLQ
APLFTSDGSWQAALSAGSLIDEDVLVTGNFGSRPQENFAALSLFLEDHGKKWPLMCMEFW
DGWFNRYKEPIIKRDPQETVDTIMETIALGNINLYMFHGGSNFAFMNGCSARGKIDLPQV
TSYDYDAILDEAGNPTKKYRLLQKSMQELFPNHDYHEPLVKETMEIKDIPLVNKVSLVST
LDKLSDVTKTYYPLNMEDLGQSTGYIFYRTKINKESAEVEKISLIDARDRVQIFQNNQWL
ATQYQEEVGQEVLINLEEENNLDLLIENMGRINYGPRLTAPSQSKGLGSGLIADLHFVGN
WGIYPLPMDDISAIDYTNQWLPNTPAFYEFQFDCQDCQDTYIDMTGFGKGLVFINGKNLG
RFWEVGPIVSLYLPKSYLITGNNKLTVFETEGKYRNKINLVKHPIIIDVKGENL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatttactatttccgatcaattctatatggatggtaaaccttttaaaatttta
tctggttcgattcattattttagaataccaaaagaatcttggtatcattcactttataat
ctgaaagctcttggttttaatactgttgaaacctatgttccatggaattatcatgaggca
aaagaagaaacttataacttttcagataatcatgatctagatttctttttaagtcaagcc
caagaactaggattatatgtacttcttagaccatcaccttatatttgtgcagaatgggaa
tttggtggtttacccgcttggctactgaccaaaaaggttaaagtacgatcaacggatccc
aattaccttttttatgtgaatcgatactatgacaaattaataccaattcttaagaagcat
gaattagctaatggtggtaacatcattatgcatcaggtagaaaatgagtatgggtcatat
ggtgatgaaaaagcctacttgaaagctttaaaaacgatgatggttgaaaaaggtttacag
gctcccttatttacatcagatggttcatggcaggcagcactaagtgctggaagtttaatt
gacgaagatgttctggttaccggaaattttggctccagaccgcaagaaaattttgctgcc
ttatctttatttttggaagaccatggtaaaaagtggcccttgatgtgtatggaattctgg
gatggttggttcaatcgttataaagaaccaataatcaaaagagatcctcaagagactgtt
gatacaatcatggaaacgatagctctgggcaatattaatttatacatgttccatggtggt
agtaactttgcttttatgaatggatgctctgctagaggaaagattgatttaccacaagtt
acttcttatgattatgacgcaatattggacgaagctggcaatccaacaaagaaataccga
ctattgcaaaagagcatgcaagaattatttcccaatcatgattatcatgaaccactggtg
aaagaaacaatggaaattaaggatattcctttagttaacaaagtttctttagtttcaact
cttgacaagctttcggatgtcacgaagacatattatcctcttaatatggaagatcttgga
caatcaactggttacattttctaccgtacaaaaattaataaagaaagtgcagaagttgaa
aaaatttctttgatcgatgctcgagatcgcgtgcagattttccaaaataatcaatggcta
gcaactcaatatcaagaggaagtaggtcaagaagttttgataaacctcgaagaggaaaat
aatcttgatttgctaattgaaaatatggggcgcattaattatggacctcgacttacagca
cctagtcaaagtaaaggtctaggaagtggattgattgccgatcttcattttgtagggaac
tgggggatttatccgttgcctatggatgacatttcagctattgattatacgaatcagtgg
ttaccaaatactccggctttctatgaatttcaatttgactgtcaagattgtcaggatact
tatattgatatgacaggatttggaaaaggccttgtgtttatcaatggcaaaaatttaggc
agattttgggaagtaggtcccatagtaagtctttatcttccaaaatcttatttaataact
ggaaacaataagttaactgtttttgaaacagaaggtaaatatagaaataaaataaattta
gtaaaacatccaataatcatagatgttaaaggagaaaacttatga

DBGET integrated database retrieval system