KEGG   Streptococcus parauberis: STP_0488Help
Entry
STP_0488          CDS       T01504                                 

Definition
(RefSeq) 1,4-alpha-glucan-branching protein
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
stk  Streptococcus parauberis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STP_0488
Enzymes [BR:stk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     STP_0488
Exosome [BR:stk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STP_0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
522811..524694
Genome map
AA seq 627 aa AA seqDB search
MTNDLDLYTFGTGENFHIQDYFGVHKTSQNGEQAYVFRVWAPNAETISLIGDFTNWFENP
VPMEVNEAGVWEVISNLPKEGQIYKYLVKRQGGHVIEKIDPLAIVFENRPGTGAKVKTLT
PKKWQDGLWMGRRKRFGFKKRPVNIYEMHANSWKNDNEGQPYQFKELKNELIPYLKKMNY
THVEFMPLMAHPLGMSWGYQLMGYFAFETTFGNPEDFQDFVEECHLNNIGVLVDWVPGHY
TKNDDALAYFDGTPTYEYQDHDRAHNYGWDALNFDLGKNQVQSFLISSAMFWLETYHLDG
IRVDAVSNMLYLDYDQGPWQPNVNGGNHNLEAIAFLQKLNQTIKDKYPDVMMIAEEATSD
IPITKPISEGGLGFDYKWNMGWMNDVLRFYEQDPFYRKFNFNLLTFSFMYCFNENFILPF
SHDEVVHGKKSLMHKMWGDRNNQFSGLRNLLTYQICHPGKKLLFMGSEFGQFLEWKYDDQ
LVWDNLNDDLNQKMAYFTATLNQFYKDNNSLWQNDENYDGIEIIDADNLDQTVLSFCRQN
DKGDLLLCVFNMTPVERPNFTIGVPVAGQYEEIFNTELEVFGGVWKETNPNKTTENEDWK
SYHETLTFTLPALGASIWKVKRRIRRK
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgacttagatctttatacttttgggactggggaaaattttcatattcaagat
tactttggagtacataaaacaagtcaaaatggcgaacaagcgtatgtcttcagagtttgg
gcaccaaatgcggagacaattagtttaattggagattttactaattggtttgaaaatcca
gttccaatggaagtaaatgaagctggagtttgggaagttataagcaacttaccaaaagaa
ggccaaatatataaatatctagtcaagaggcaaggtggacatgttattgaaaaaattgat
ccgctagctattgtattcgaaaaccgtccaggaactggagcaaaagttaaaacacttact
cctaaaaagtggcaagatggtttatggatgggaagacggaaacgttttggctttaaaaaa
cgtcccgttaatatctatgaaatgcatgctaactcttggaaaaatgacaatgaaggccaa
ccttatcagtttaaagagctgaaaaatgaattaatcccttatcttaagaaaatgaattat
acccatgtcgaatttatgccacttatggctcatccattaggtatgagttggggttatcaa
ttaatgggatattttgctttcgaaactacatttggcaatccagaagatttccaggatttt
gttgaagaatgtcatctaaataacattggagttttagttgactgggtaccaggacattat
acaaaaaatgatgatgcccttgcttatttcgatgggacacctacatatgaatatcaagat
catgatcgggcacataactatggttgggatgcactaaattttgatttaggtaagaatcaa
gtacagtcatttttgatttcaagcgctatgttttggttggaaacctatcatttagacggt
atcagagttgatgctgtaagtaatatgctctaccttgattatgatcaagggccatggcaa
ccaaatgttaatgggggtaaccataatctagaagcaattgcatttttgcaaaaattgaat
caaacaattaaagataaatatcctgatgtcatgatgattgcagaagaagcaacttcagat
attccaataactaaaccaatttcagaaggtggacttggctttgattataaatggaatatg
ggatggatgaatgatgttttaaggttttacgaacaagatccattttaccgtaaatttaat
tttaacttgttgacttttagctttatgtattgttttaatgagaattttattcttcctttt
tcacatgacgaagttgtacatggtaaaaaaagtctaatgcataaaatgtggggtgaccga
aataaccaatttagtggattaagaaatttactaacctaccagatttgtcatccagggaaa
aaattattattcatgggatctgaatttggccaatttctcgaatggaaatatgatgatcaa
ttggtttgggataatttaaatgatgatcttaaccaaaaaatggcatatttcaccgcaacc
ttaaatcaattttacaaagataataatagtctttggcaaaatgacgaaaattatgatggt
attgaaataattgatgcagataacttggatcagacagtcctatccttctgtcgtcaaaac
gataaaggtgatttattgctttgtgttttcaatatgacaccagtagagcgtcctaatttc
acaattggtgttccagtagctggtcaatatgaagaaatatttaatactgaacttgaagtt
ttcggtggtgtatggaaagaaacgaatccaaacaaaacaactgaaaatgaagattggaaa
tcttatcatgagacattgacatttactttaccagcattaggtgctagtatttggaaagtt
aaacgtcgcattaggagaaaataa

DBGET integrated database retrieval system