KEGG   Streptococcus parauberis: STP_0607Help
Entry
STP_0607          CDS       T01504                                 

Gene name
dyr
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
stk  Streptococcus parauberis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STP_0607 (dyr)
   00670 One carbon pool by folate
    STP_0607 (dyr)
Enzymes [BR:stk01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     STP_0607 (dyr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646596..647111
Genome map
AA seq 171 aa AA seqDB search
MTKEIIAIWAEDENGVIGVNGILPWHLPKELQHFKKTTLNHTILMGRVTFEGMQRRLLPN
RQTIVLTSDDQYQVDGVLTMTSVEQVLDWFKTQEKNLYIIGGSKVLKAFDGHFDKIIKTL
VNHQFDGDTYSPELDLSQFTEVNSQYFEKDEKNPYDFTVHVFENNKTVGGK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaattattgccatttgggctgaagatgaaaatggagttattggtgtcaat
ggtatcttaccttggcatcttccaaaagaactgcaacattttaaaaagacaacattaaac
catacgattcttatgggacgagtgacttttgaaggaatgcagagacgtcttttaccaaat
cgacaaacaatagttttaacttcagatgatcagtatcaagttgatggtgtattaaccatg
acaagtgtcgaacaagtccttgactggtttaagacacaagaaaaaaatctctatattatc
ggtggcagtaaagttttgaaggcctttgatggtcattttgacaaaattattaaaacacta
gttaatcatcaatttgatggagatacctatagtccagaattggatttaagtcagttcaca
gaagtcaattctcaatattttgaaaaagatgaaaaaaatccttatgatttcacagttcac
gttttcgaaaataataaaacggttggaggaaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system