KEGG   Streptococcus parauberis: STP_0629Help
Entry
STP_0629          CDS       T01504                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
stk  Streptococcus parauberis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:stk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
669714..670274
Genome map
AA seq 186 aa AA seqDB search
MNIEKAEQAIYDLLEAIGENPNREGLLDTPKRVAKMYQEMFSELQADPKDQFTAVFTENH
EDAVIVKDIYFHSMCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQERL
TAQVADALEEALHPKGVFVMLEAEHMCMTMRGIRKPGSKTITTTARGIYQTDREERKEIL
SLINEK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagaaaaagcagaacaagccatttatgatttattagaagctattggagaaaac
cccaatcgtgaaggacttttagatacacctaaacgggtagccaagatgtatcaggaaatg
ttttccgaattacaggctgacccaaaagatcaattcacagccgtttttacagagaatcat
gaagatgctgtaattgttaaagatatctatttccactccatgtgtgagcaccatttagtc
cctttttatggcaaagctcacattgcttatttgccaagtgatggtcgtgtgactggttta
agtaaattggccagagccgtagaagtagctagtaaacgtccacagctacaagaaagacta
acagcgcaagtagctgatgcgttggaggaagccttacatccaaaaggtgtctttgttatg
ttagaagcagaacatatgtgcatgaccatgcgtggtattagaaaacctggaagtaaaaca
attaccaccacggcgcgaggtatttatcaaactgatcgtgaagaaagaaaagaaatttta
agcttaattaatgagaagtag

DBGET integrated database retrieval system