KEGG   Streptococcus parauberis: STP_0629Help
Entry
STP_0629          CDS       T01504                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
stk  Streptococcus parauberis
Pathway
stk00790  Folate biosynthesis
stk01100  Metabolic pathways
Module
stk_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STP_0629 (folE)
Enzymes [BR:stk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     STP_0629 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI BCDHK_Adom3
Motif
Other DBs
NCBI-ProteinID: AEF25077
Position
669714..670274
Genome map
AA seq 186 aa AA seqDB search
MNIEKAEQAIYDLLEAIGENPNREGLLDTPKRVAKMYQEMFSELQADPKDQFTAVFTENH
EDAVIVKDIYFHSMCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQERL
TAQVADALEEALHPKGVFVMLEAEHMCMTMRGIRKPGSKTITTTARGIYQTDREERKEIL
SLINEK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagaaaaagcagaacaagccatttatgatttattagaagctattggagaaaac
cccaatcgtgaaggacttttagatacacctaaacgggtagccaagatgtatcaggaaatg
ttttccgaattacaggctgacccaaaagatcaattcacagccgtttttacagagaatcat
gaagatgctgtaattgttaaagatatctatttccactccatgtgtgagcaccatttagtc
cctttttatggcaaagctcacattgcttatttgccaagtgatggtcgtgtgactggttta
agtaaattggccagagccgtagaagtagctagtaaacgtccacagctacaagaaagacta
acagcgcaagtagctgatgcgttggaggaagccttacatccaaaaggtgtctttgttatg
ttagaagcagaacatatgtgcatgaccatgcgtggtattagaaaacctggaagtaaaaca
attaccaccacggcgcgaggtatttatcaaactgatcgtgaagaaagaaaagaaatttta
agcttaattaatgagaagtag

DBGET integrated database retrieval system