KEGG   Streptococcus parauberis: STP_0655Help
Entry
STP_0655          CDS       T01504                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stk  Streptococcus parauberis
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STP_0655
Enzymes [BR:stk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     STP_0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
696782..698221
Genome map
AA seq 479 aa AA seqDB search
MSNQAKFPKDFLWGGATAANQCEGAYDVDGRGLANVDLVPIGEDRFPIIAGERKMFDFED
GYFYPAKESIDFYHHYKEDIALFAEMGFKTYRMSIGWSRIFPNGDETEPNEKGLEFYENV
FKECRKYGIEPLVTITHFDCPMHLIEEYGGWRNRKMIDFYGNLCHVIFNRYKGLVKYWLT
FNEINMILHAPFMGAGICFEEGENKEEVKFQAAHNELVASALATKIAHEIDPDNKVGCML
AAGQYYPNTCDPKDYWAGMKEDRENYFFIDVQARGYYPNYALKKFERDNLNIEMTEDDLA
LLKEHTVDFISFSYYSSRVASGDPKVNEETQGNIFASIKNPYLDSSEWGWQIDPLGLRIT
MNAIWDRYQKPLFVVENGLGAIDTPDENGDIEDDYRIDYLRQHIQTMNDAINIDGVELWG
YTTWGCIDLVSAGTGEMKKRYGFIYVDRDNDGNGTLKRTKKKSFDWYKKVIASQGTDLD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatcaagcaaaatttcctaaagattttctttggggaggtgcaacagctgccaat
caatgtgaaggtgcttacgatgtcgatggacgtggtttagctaacgttgacctagttcca
attggtgaagatcgtttcccaattattgctggtgaaagaaaaatgtttgactttgaagat
ggctatttttacccagcaaaagaatcaattgatttctaccatcattacaaagaagatata
gctttatttgctgaaatgggctttaaaacgtaccgtatgtcaattggctggtcacgtatt
tttcctaatggtgatgaaactgaaccaaatgaaaaaggtttagaattctatgaaaatgtt
tttaaagagtgccgtaaatatggtattgaaccgcttgtaacaatcactcactttgattgt
ccaatgcacttaattgaagaatatggtggatggcgtaaccgtaagatgattgatttctac
ggaaacctatgccatgttatttttaaccgttataaaggtcttgttaaatactggttgact
ttcaacgaaattaatatgattcttcatgcaccatttatgggagcaggtatttgttttgaa
gaaggcgaaaataaggaagaagtaaaatttcaagctgcccataatgaattggtggcgtca
gccttagcaactaagattgctcatgaaatagatcctgacaataaggtcggatgtatgtta
gctgctgggcaatattacccaaatacttgtgatccaaaagattactgggctggtatgaaa
gaagatcgtgaaaattacttctttatcgatgttcaggcgcgtggttattatccaaattat
gctttgaagaaatttgaacgtgataatttgaatattgagatgactgaagatgatttagct
ttgttaaaagaacatacagttgacttcatttcattctcttattattcaagtcgtgttgct
tcaggagatccaaaggtaaatgaggaaacacaaggaaatatctttgcttcaattaaaaat
ccttacttagattcttctgaatggggatggcagattgacccacttggacttcgtattaca
atgaatgccatttgggatcgttatcaaaaaccactgtttgtagttgaaaatggactcggt
gctattgatacgcctgatgaaaatggtgatattgaagatgactaccgtattgactatctt
cgtcaacatattcaaaccatgaatgatgctattaatatcgatggcgttgagttatggggc
tatacaacatggggttgtattgacttagtttcagcaggtacaggtgaaatgaaaaaacgt
tatggctttatttatgtagatcgtgacaatgacggaaacggaactttaaagcgtactaag
aaaaaatcatttgattggtataaaaaagttattgcaagtcaaggtactgatttagattaa

DBGET integrated database retrieval system