KEGG   Streptococcus parauberis: STP_0681Help
Entry
STP_0681          CDS       T01504                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
stk  Streptococcus parauberis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    STP_0681 (tdk)
Enzymes [BR:stk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     STP_0681 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
722677..723258
Genome map
AA seq 193 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSSLDTRDGFGIVSSRIGMKRQAI
PINDQMDIYAYVDGLVQKPYCVLIDECQFLSKGNVYDLARVVDDLGVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIEEIKTICQYCSKKAIMQLRMKDGVPVYAGEQIQIGGNETYIPVC
RKHYFQPPMLRED
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaattatactacaagtatgggacaatgaattctggcaagacgattgagatttta
aaagtagcacacaattatgaggagcagggcaaacctgttgttatcatgaccagttcttta
gatacaagagatggttttggcatagtttccagtaggattggtatgaagcgccaagcaatt
cccatcaatgatcaaatggatatctatgcatatgttgatggtttagttcaaaaaccatat
tgcgtcttgattgatgagtgccaatttttgtccaaaggaaatgtttatgatttagcccgt
gtggtagatgatttaggtgttccagttatggcttttggtcttaaaaatgatttccaaaat
gagctttttgaaggatcgaaatatctacttcttttagctgataagattgaggaaattaag
acaatttgtcaatattgtagtaaaaaggctataatgcaacttcggatgaaagatggtgtt
ccagtctatgctggggagcaaattcaaatcggtggaaatgaaacttatataccggtttgt
cgtaaacattatttccaaccaccaatgttaagagaagattaa

DBGET integrated database retrieval system