KEGG   Streptococcus parauberis: STP_0701Help
Entry
STP_0701          CDS       T01504                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
stk  Streptococcus parauberis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:stk00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:stk00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
743605..744087
Genome map
AA seq 160 aa AA seqDB search
MTSLYDFTVKDQHGEDISLSQFQGKVLLIVNTATGCGLTPQYQGLQELYDQYVDKSFVIL
DFPCNQFAGQAPGNAEEINNFCSLNYQTTFPRFAKVNVNGKEADPMYVWLKAQKKGLLGK
AIEWNFAKFLIDKNGQVVKRYSSKTAPQEIRQDLEILLKD
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacatcactttatgattttacagttaaagaccaacatggagaggacatttcccttagt
cagtttcaaggtaaggtacttctcatcgtcaatacagcaacgggctgtggtttgactccc
caataccaaggtctccaggaactttacgatcagtatgtcgacaaaagttttgtgattcta
gactttccttgtaatcaatttgctgggcaagcacctggtaatgccgaagaaattaataac
ttttgtagtctcaattaccaaacaacttttcctagattcgctaaggtaaatgtgaatggt
aaagaagcggacccaatgtatgtttggttaaaagctcaaaagaaggggttactaggtaaa
gcaattgaatggaacttcgccaaatttctgattgacaaaaatggccaagtcgtaaaacgt
tattcctctaagaccgcccctcaagagattcgtcaggatttagaaattttattaaaggac
tag

DBGET integrated database retrieval system