KEGG   Streptococcus parauberis: STP_0833Help
Entry
STP_0833          CDS       T01504                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stk  Streptococcus parauberis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STP_0833 (pfk)
   01230 Biosynthesis of amino acids
    STP_0833 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STP_0833 (pfk)
   00030 Pentose phosphate pathway
    STP_0833 (pfk)
   00051 Fructose and mannose metabolism
    STP_0833 (pfk)
   00052 Galactose metabolism
    STP_0833 (pfk)
  Energy metabolism
   00680 Methane metabolism
    STP_0833 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    STP_0833 (pfk)
Enzymes [BR:stk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STP_0833 (pfk)
Protein phosphatases and associated proteins [BR:stk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STP_0833 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(877769..878491)
Genome map
AA seq 240 aa AA seqDB search
MVLGGDGSYHGAMRLTEHGFPAIGIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTS
SSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEGYDINKVVATIDEDFNKKGKNHH
IIVLAEGVKSGEEFAKELKEAGNNTDTRVTNLGHILRGGSPTARDRVIASWMGSHAVKLL
KEGKGGLAVGIHNEELVESPILGTSEEGALFSLTDDGKIVVNNPHKARLDFAELNRTLNR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtggtattaggtggagatggttcttatcatggagctatgcgtcttactgaacatggattc
ccagcaatcggaattcctggtactattgacaatgatatcgctggaactgactacacaatt
ggtttcgatacagctgttaatacagccgttgaagctattgataaacttcgtgatacttca
tcaagtcatggtcgtacatttgtagttgaagtaatggggcgtaacgctggtgatattgca
ctttgggcaggtattgcaagtggagctgatcaaattattgttcctgaagaaggttatgac
attaataaagtagttgctactattgatgaagactttaataaaaagggtaaaaaccatcat
attatcgtattagctgaaggtgttaagagtggtgaggaatttgctaaagagctcaaagaa
gctggcaataatactgatacacgtgtaacaaacctgggtcacattttgcgtgggggttca
cctactgcaagagatcgtgttattgcttcttggatgggttcacatgctgtgaaacttctt
aaagaaggaaaaggtggtctagctgtaggtatccataatgaagaacttgtcgaaagtcca
attcttggaacttcagaagaaggagcattattctcacttactgatgacggtaaaattgtt
gttaataatccacacaaagcacgtttagattttgcagaattaaaccgtacacttaataga
taa

DBGET integrated database retrieval system