KEGG   Streptococcus parauberis: STP_0891Help
Entry
STP_0891          CDS       T01504                                 

Gene name
pyrF
Definition
orotidine 5'-phosphate decarboxylase
Orthology
K01591  
orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
stk  Streptococcus parauberis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    STP_0891 (pyrF)
Enzymes [BR:stk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     STP_0891 (pyrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(945359..946051)
Genome map
AA seq 230 aa AA seqDB search
MHEERPIIALDFPSFEEMKSFLGLFPKEEKLYVKIGMELYYAVGPEIVRYVKALGHSVFL
DLKLHDIPNTVMSTMEVLSKMGIDMTTVQAAGGVEMLQAARKGLGQGPILIAVTQLTSTS
EEMMREDQNIQSTLLESVLHYAKRTVIAGLDGVVCSAHEVEAIKEVTPDNFVCLTPGIRP
TGSDIGDQKRIMTPSQAKTIGSDYIVVGRPITLADDPVASYHAIKAEWNA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaagaacgtccgattattgctcttgatttcccgtcatttgaagaaatgaaatct
tttttaggtttatttcccaaagaagaaaagctttatgtcaaaatagggatggaactctac
tacgccgtaggtcctgaaattgttcgctatgtgaaggcgcttggtcacagcgtctttctt
gatttgaaattgcacgatattcctaacaccgttatgtcgacaatggaagttctgtcaaaa
atggggattgatatgacaaccgtccaagctgctggtggtgttgaaatgctccaagccgcg
cgtaagggcttaggtcaaggtccaatcttgattgcagtgacacaattaacgtcaaccagt
gaagaaatgatgcgtgaagatcagaacattcaatcgacacttctagaatctgttttacat
tatgctaaacggactgtaattgccggattagacggtgtcgtttgttcagcacatgaagtt
gaagcaattaaagaagtaacgccagataactttgtttgtttaacccctggcattcgtcca
actggttctgatattggtgaccagaagcgtattatgacacctagtcaagctaaaacaatt
ggtagtgactatattgttgttggtcgtccaatcacgcttgcagacgatcctgtggcctca
taccatgccattaaagctgaatggaatgcttaa

DBGET integrated database retrieval system