KEGG   Streptococcus parauberis: STP_0948Help
Entry
STP_0948          CDS       T01504                                 

Definition
Mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
stk  Streptococcus parauberis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    STP_0948
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STP_0948
Enzymes [BR:stk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     STP_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1006605..1007930
Genome map
AA seq 441 aa AA seqDB search
MGITAGKSAQFVLNKLGRGSTYPGKLALQMDKDILDSLAKDYEIVVITGTNGKTLTTALT
VGILKEAFGQVLTNPSGANMITGIVSTFLTAKTGKSGKKIAVLEIDEASLPKITKYITPS
LFVFTNIFRDQMDRYGEIYTTYQMIINGAKNAPEATILSNGDSPIFASKELDNPVKYYGF
NTEDHEPKLAHYNTEGILCPNCEHILNYRLNTYANLGHYICPNCQFERPELDYQLTELTN
ISHNMSEFVIDNQSYKINVGGLYNIYNALAAVSVAEFFGVAPEKIKAGFEKSRAVFGRQE
TFTIGNKTCTIVLIKNPVGASQALEMINLADFPFSLSVLLNANYADGIDTSWIWDANFEL
INQMDITEINAGGVRHSEIARRLRVTGYDETKITQAEKLEDIMVAIEAQETDHAYILATY
TAMLQFRELLANRHIVNKEMN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggcattactgccggaaaatcagctcaatttgttttgaataaacttggtcgtggatca
acttatcctggtaaattggctttacaaatggacaaggatatcttagactcccttgccaaa
gattatgaaattgtagtaatcactggaaccaatggtaaaactttaacaactgcactaact
gttggaatcttaaaagaagcttttggacaagtattaactaatccaagtggtgccaacatg
attacaggaattgtttcaactttcttaactgctaagactggtaaatccggtaagaagatt
gctgttttagaaattgatgaagcaagtcttcctaaaattactaaatatatcacaccaagt
ttgttcgtttttactaatatctttcgtgatcaaatggaccgctatggtgaaatttataca
acttatcaaatgattattaatggtgctaaaaatgctccagaagctacaatcctcagcaac
ggtgatagtccaatttttgcctctaaagagcttgataatccggtcaaatactatggtttc
aatacagaagaccatgaaccaaaattagctcattataatactgaaggaattctttgccct
aattgtgagcatattttaaactatcgtttaaacacctatgctaatttgggacattacatt
tgtccaaattgtcaatttgagcgaccagagctagactatcaattaacagaattgactaat
atcagtcataatatgtctgaatttgtaattgataatcaatcctataaaattaatgtcgga
ggcttatacaacatttataatgccctagctgccgtttcagtagctgaattcttcggagta
gctccagaaaaaattaaagctggttttgaaaagagccgtgctgtttttggtcgtcaagaa
acttttactattggcaataaaacatgtactattgtgctgattaaaaatccagttggagct
agtcaggctttagaaatgattaacttggcagacttcccattctcattatcagtcttactt
aatgccaattatgctgacggtattgatacttcttggatttgggatgctaactttgaattg
attaaccaaatggatattactgaaatcaatgctggtggtgtccgtcattctgaaattgcc
cgtcgtcttcgtgttacaggttatgacgaaactaaaattactcaagctgaaaaattagaa
gatattatggtagcaattgaagcacaagaaacggatcacgcttatattttagctacttat
acagctatgcttcaattccgagagttgcttgcaaaccgtcatatcgtgaataaggagatg
aactaa

DBGET integrated database retrieval system