KEGG   Streptococcus parauberis: STP_0952Help
Entry
STP_0952          CDS       T01504                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stk  Streptococcus parauberis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STP_0952
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STP_0952
   00020 Citrate cycle (TCA cycle)
    STP_0952
   00620 Pyruvate metabolism
    STP_0952
Enzymes [BR:stk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STP_0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1011805..1013217)
Genome map
AA seq 470 aa AA seqDB search
MAAEIIMPKLGVDMQEGEIIEWKKQEGDSVNEGDILLEIMSDKTNMEIEAEDAGILLKIV
RPAGDVVPVTEVIGYIGAEGESVENIASSEKTTEIPVPNSADAAPTVAPKEDVERPEITV
ETALPQGNGEKVRATPAARKTASEMGVSLGQVPGSGPKGRVHQEDVENFKNAQPKASPLA
RKMAEDAGLNLADITGTGFNGKVMKEDILATIKASKPAEEVVAKPAKGEKAKAELPEGVE
VIKMSAMRKAISKGMTNSYLTAPSFTLNYDIDMTEMMSLRKKLIDPIMEKTGLKVSFTDL
IGMAVVKTLMKPEHQYMNASLINDAQEIELHKFVNIGIAVGLDDGLIVPVVHNADKMSLA
DFVVASKDVIKKTQQGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIP
TPTVVNGEIVPRPIMAMCLTIDHRLVDGMNGAKFMVDLKNLMENPFGLLI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgaaattattatgcctaaactcggtgttgatatgcaagaaggcgaaatcatc
gagtggaaaaaacaagaaggcgatagtgtcaatgaaggtgatattcttctagaaattatg
tctgacaagactaatatggagattgaggctgaagatgctggtatcttgttgaaaattgtt
cgtcctgcaggagatgttgttcctgtaactgaagttattggttatattggtgctgaaggt
gaatcagttgagaatattgcttcaagtgaaaaaacaactgaaatccctgttccaaattcg
gcagatgctgccccaacggtagcacctaaagaagatgttgaaagacctgaaataactgta
gaaactgctctccctcaaggaaatggcgaaaaagttcgtgcgacacctgctgcccgtaaa
acagcttctgaaatgggtgtctcacttggtcaagttcctggttcaggacctaaaggtcgt
gttcatcaagaagatgttgaaaacttcaaaaacgctcaacctaaagcctcaccacttgct
cgtaaaatggcagaggatgctggtctcaacttagctgatatcactggtactggatttaat
ggtaaagtgatgaaagaagatatcttagctacaatcaaagcatctaaaccagctgaagaa
gttgttgctaaaccggcaaaaggagaaaaagcgaaagctgaacttcctgaaggtgttgaa
gttatcaagatgtctgcaatgcgtaaagcaatctctaaaggtatgactaactcttaccta
acagctccgtcattcacattgaactatgatattgatatgactgagatgatgtctcttcgt
aaaaaattaattgacccaatcatggaaaaaactggtttgaaagtaagttttactgactta
attggtatggctgttgttaaaacattgatgaaaccagaacatcaatacatgaatgcttca
ttaatcaatgacgctcaagaaattgaattacacaaatttgtaaatattggtattgccgtt
ggtcttgatgatggattaattgtaccagtagttcacaatgcagataagatgtcacttgct
gatttcgttgttgcatcaaaagatgtcattaagaaaactcagcaaggtaaattaaaagct
gctgaaatgtcaggttcaacattctctattacaaatttaggtatgtttggtactaaaaca
tttaaccctatcattaaccaaccaaactcagcaatcttaggtgttggagcaactattccg
acaccaactgtagttaatggtgaaatcgttcctcgtccaatcatggcaatgtgtttaaca
attgaccatagacttgttgatggcatgaacggtgctaaattcatggttgatcttaaaaac
ttaatggaaaatccatttggactattaatctga

DBGET integrated database retrieval system