KEGG   Streptococcus parauberis: STP_0993Help
Entry
STP_0993          CDS       T01504                                 

Gene name
malM
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
stk  Streptococcus parauberis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:stk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1055834..1057342)
Genome map
AA seq 502 aa AA seqDB search
MSKRASGILMHISSLPGKFGIGTFGKSAFNFVDFLRDTKQSYWQILPLSMTSFGDSPYQS
FSAVAGNTHFIDFDNLTKAGYLSEDDYKDVNFGDNPESVDYAIIFNTRRPILETAVRNFM
ASKDGQKQLSTFEESAQWVRDFAEFMAIKEYFGNKALQEWDDKSIIKREESALEFYRDKL
EEAITYHKVCQFFFYQQWLELKLYANANGIEIIGDMPIYVSADSVEVWTMPELFKVDADK
KPIYIAGVPADGFSEDGQLWGNPIYNWLEHEKTNFSWWVYRIKESIKLYDKVRIDHFKGF
SDFWEIPGGDTTARNGHWESAPGLALFETVRDELGDLPIIAENLGYIDERAEKLLKATGF
PGMKILQFGLFDHISQSFDLPHNYDTNCIVYTGTHDNEVVNGWYENMTVKQARFAEAYIS
RAADETITEAMLRTIFASVGDTAILCMQDLLDKEADSRMNIPNTLGGNWQWRMLEEDLTE
AHKEYLIHLTDLYGRANANKEK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgagcaagtggcattttaatgcatatcagttcattaccagggaaatttggt
attggaacatttgggaaatcagctttcaactttgttgatttcttaagagatacaaaacaa
tcatattggcaaattctaccattatcaatgacaagttttggtgattcaccttatcaatca
ttttctgcagtagcaggaaacacacactttattgattttgataatttaacaaaagctggt
taccttagtgaagatgactacaaggacgtaaattttggtgataacccagaatcagttgat
tatgctataatctttaatacacgtcgtccaatcctcgaaactgctgtgagaaactttatg
gctagtaaggatggtcaaaaacaactgtcaacattcgaggaatcagcacaatgggttagg
gattttgctgaatttatggctattaaagagtactttggtaataaagcgttacaagaatgg
gatgataaatcaatcatcaaacgtgaggaaagtgctcttgaattctaccgtgataaatta
gaagaagcgattacttatcataaagtttgtcaatttttcttttatcaacagtggttagaa
ttaaaattatatgctaatgccaacggtattgaaattattggtgacatgccgatttatgtt
tcagctgatagtgtggaagtttggactatgcctgaactatttaaagttgatgctgataaa
aaaccaatttatattgctggcgtacctgctgatggttttagcgaagatggtcaactttgg
ggtaatcctatctataattggttagaacatgaaaaaactaatttttcatggtgggtttat
cgtattaaagaaagcattaaactctatgacaaagttcgtatcgaccactttaaaggtttt
tctgatttctgggaaattcctggaggtgacactacagcaagaaatggccactgggaatct
gctcctggtctagctttatttgaaactgttcgtgatgaactaggagatctaccaatcatt
gccgaaaacctaggttatatcgacgaaagagcggaaaaactcttgaaagctactggcttt
ccaggtatgaaaattcttcaatttggtttatttgatcatatcagccaaagctttgattta
cctcataattatgatactaattgtattgtctatacaggtactcatgataatgaagtagtt
aatggttggtatgaaaatatgactgtgaaacaagcacgtttcgcagaagcttatattagt
cgtgcagcagatgaaactattacagaagcaatgttaagaactatttttgcatctgttgga
gatacagcaatcttatgtatgcaagatttgcttgacaaagaagctgacagccgaatgaac
attccaaatacacttggaggaaactggcaatggcgtatgttagaagaagatttaactgaa
gctcataaagaatatcttatccatttaactgacctttatggaagagcaaatgctaataaa
gaaaaataa

DBGET integrated database retrieval system