KEGG   Streptococcus parauberis: STP_1044Help
Entry
STP_1044          CDS       T01504                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
stk  Streptococcus parauberis
Pathway
stk00520  Amino sugar and nucleotide sugar metabolism
stk00550  Peptidoglycan biosynthesis
stk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STP_1044
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STP_1044
Enzymes [BR:stk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     STP_1044
Peptidoglycan biosynthesis and degradation proteins [BR:stk01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   STP_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AEF25492
Position
complement(1112772..1114031)
Genome map
AA seq 419 aa AA seqDB search
MRKIIINGGKPLSGEVAVSGAKNSVVALIPAIMLADDVVTLDGVPSISDVDSLIEIMELM
GAKITRQNDSLTIDPRTVISQPIPFGKINSLRASYYFYGSLLGRFGQATVGLPGGCDLGP
RPIDLHLKAFEAMGAKVSYVGENMHIAVNEGELHGAHIYMDTVSVGATINTMLAATKANG
KTVIENAAREPEIIDIATLLNNMGAHIRGAGTDIITIEGVTKLGSTTHQVIPDRIEAGTY
IAMAAAIGTGIKVTNVLYEHLESFIAKLEEMGVRMTIEEDSIFVEKQDKLKAVTIKTSPY
PGFATDLQQPLTPLLLTTEGMGSIVDTIYEKRVNHVPEMARMGADISLKGGKIVYHGPNQ
LSGAQVKATDLRAGAALVTAGLMAEGKTEIRNIEFILRGYANIIEKLQDLGADIQLIEE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaattataattaatggtggaaaacctttatcaggagaagttgctgtctccggt
gcaaaaaatagtgttgttgccttaatcccagcgattatgctagctgatgatgttgtcaca
ttggatggagttccatcaatcagtgatgtggatagtttaattgaaatcatggaattgatg
ggtgccaaaattactcgtcagaacgattcacttacaattgatcctagaacagtaattagt
caaccaattccttttggtaaaattaatagtttgagagcttcttattatttttatggaagt
ttacttggacgttttggtcaagctactgtcggtctaccaggtggttgtgatttggggcca
agaccaattgacttacatttgaaagcttttgaagcaatgggagctaaagtatcttatgtt
ggtgaaaatatgcatattgccgttaatgaaggtgaactgcatggcgcacatatctacatg
gatacagtcagtgtaggtgcgacaatcaatacaatgcttgctgctacaaaagcaaatggt
aagactgtcattgaaaatgccgcgcgtgaaccagaaattattgatattgcaacgctttta
aataatatgggggctcatattcgtggagcgggaacagatattataactattgaaggagtt
acaaaattaggctcaacaactcaccaagttattcctgacagaattgaagctggtacttat
attgcaatggcagcagcaattggaacagggataaaggtaacaaatgtcttatatgaacat
ttagaaagttttattgcgaaacttgaagaaatgggagttaggatgacaattgaggaagat
tcaatttttgttgaaaaacaagataaattgaaagctgtaaccattaaaacctcaccatat
cctggttttgcaacagatctacaacaaccattaacaccattactgcttacaacagaaggc
atgggatcaattgttgatacgatttatgaaaaacgggtcaaccatgtcccagaaatggct
cgtatgggcgctgatatttctctaaaaggtggcaaaattgtctaccatggtcctaatcaa
ttaagcggtgcacaagtcaaagctactgacttgcgagcaggtgcagcactagtaactgcg
ggactaatggccgaaggaaaaacagaaattcgcaacattgaatttattttacgcggctat
gccaatatcatcgagaaacttcaagatttaggagcagacatacaattaattgaagaataa

DBGET integrated database retrieval system