KEGG   Streptococcus parauberis: STP_1133Help
Entry
STP_1133          CDS       T01504                                 

Gene name
glkA
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
stk  Streptococcus parauberis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STP_1133 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STP_1133 (glkA)
   00052 Galactose metabolism
    STP_1133 (glkA)
   00500 Starch and sucrose metabolism
    STP_1133 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    STP_1133 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STP_1133 (glkA)
   00524 Butirosin and neomycin biosynthesis
    STP_1133 (glkA)
Enzymes [BR:stk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     STP_1133 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1213011..1213754)
Genome map
AA seq 247 aa AA seqDB search
MAQKLLGIDLGGTTVKFGILTLDGQVQEKWAIETNILEDGKHIVPDIVASIKHRLDLYGL
TKDDFLGIGMGSPGAVDREKNTVTGAFNLNWKDTQEVGSVIEAEVGIPVAIDNDANVAAL
GERWVGAGENNPDVIFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEAENGFACTCG
SHGCLETVASATGVVKVARLLAESYEGDSQIKKQLITAKLLQVKISLKRLKMGIHSLTQL
LKKFLST
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaattattggggattgatttaggtggcacaactgtaaaatttggtattctt
actttagatggacaagttcaagaaaaatgggcaattgaaacgaatattttagaagatggt
aaacatattgttcccgatatcgtagcttctataaaacaccgtttagacttatatggttta
acaaaagatgattttcttggaattgggatgggctctccaggtgccgttgaccgtgaaaaa
aatactgtaactggcgctttcaacttaaactggaaagatacccaagaagtgggctcagtc
attgaagcagaagttggcattccggtcgctattgacaatgatgctaatgttgcagcatta
ggagaacgttgggtaggtgctggtgaaaacaatccagatgttatctttatgacccttgga
actggtgttggtggtggaatcattgctgacggaaacctaattcatggtgttgccggtgcc
ggtggggaaattggtcacatgattgttgaagctgaaaatggttttgcttgtacttgtgga
agccatggctgtctagaaacagtagcctccgcaacaggtgttgttaaagtggctagactg
cttgccgaaagctatgaaggcgattcacaaattaaaaagcaattgataacggcgaagctg
ttacaagtaaagatatctttgaagcggctcaaaatggggatacattcgctgactcagttg
ttgaaaaagtttctttctacctag

DBGET integrated database retrieval system