KEGG   Streptococcus parauberis: STP_1145Help
Entry
STP_1145          CDS       T01504                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
stk  Streptococcus parauberis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STP_1145 (rbsK)
Enzymes [BR:stk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     STP_1145 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1226470..1227381)
Genome map
AA seq 303 aa AA seqDB search
MTRIVIIGSISMDLVMETSRIAEEGETVFGDRFSMVPGGKGANQAVAVGRLSDSRDKIAM
IGCLGQDSFAPILKQNLQDNHLSVECVGTVPSSCGIAQITLYHQDNRIIYCPGANGLVDP
NQWQAEWDLLTESDLVILQNEIPHNANLAIAKFCHDHGVKVLYNPAPSRETDLEMISIVD
FMTPNHHECMELFPARSLEDILHDYPNKLIVTLGKEGAMYFDGEEVQHISAIIADAVDTT
GAGDTFNGAFGFALAKGLEIKEAIRFATLASHISVQKFGAQGGMPTLEEMKGHEKYEENW
NFK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtatagtaattattggtagtatttcaatggacttagttatggaaacaagtcgc
attgcagaagaaggagaaactgtttttggcgatcgtttttcaatggtacctgggggtaaa
ggagctaaccaagctgttgctgtcggacgattgagtgacagccgagataagatagccatg
attggttgtctcggtcaggattcatttgctccgattctcaaacaaaacctacaagataat
catttatctgtagagtgtgtgggaacggtaccatcatcatgtggaattgcccaaattact
ctttaccaccaggacaatcggattatctattgtcctggtgcaaatggtctcgttgatcct
aatcaatggcaagcagagtgggatttactgacagagtctgatttagttattttacaaaac
gaaattccccacaatgccaatttagcaattgcaaaattctgtcatgatcatggggttaaa
gttctatataatccggccccttctcgtgaaactgacttggagatgatttcaattgttgat
tttatgacaccaaaccatcatgaatgtatggaactttttccggctcgttcacttgaagat
attttacatgattatccgaataagttgattgtgacactcggaaaagaaggcgctatgtac
tttgacggagaagaagtgcaacacatttcagctattatagcggatgcagtggatacgaca
ggtgctggtgatacctttaacggagcctttggctttgctcttgctaaagggttagaaatt
aaagaagccattcgttttgctaccttagcttcccatatatctgttcaaaaatttggtgcg
caaggtggaatgccaactcttgaagaaatgaaaggtcatgaaaaatatgaagaaaactgg
aattttaaatag

DBGET integrated database retrieval system