KEGG   Streptococcus parauberis: STP_1711Help
Entry
STP_1711          CDS       T01504                                 

Gene name
hasC
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
stk  Streptococcus parauberis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STP_1711 (hasC)
   00052 Galactose metabolism
    STP_1711 (hasC)
   00500 Starch and sucrose metabolism
    STP_1711 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    STP_1711 (hasC)
Enzymes [BR:stk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     STP_1711 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1961973..1962878
Genome map
AA seq 301 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKA
KRSIEDHFDSNFELEYNLKQKGKTELLKLVDETTSINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFIVMLGDDLMDITDNSVIPLTRQLMNDFETTHASTIAVMKVPHEDVSSYGVIAPHG
KAHHGLYSVSTFVEKPKPEDAPSDLAIIGRYLLTPEIFEILENQAPGAGNEIQLTDAIDT
LNKTQRVFAREFTGNRYDVGDKFGFMKTSIDYALKHEQVKDDLKKYIIQLGKELEGKTET
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagtaagaaaagcaattattcctgccgcaggacttggaacaagatttttacca
gccacaaaagcactagccaaggaaatgttgcctatcgttgacaaaccaacaattcaattt
attgttgaagaagcattaaaatctgggattgaagaaatcctgattgttactggtaaagca
aagcgttccatcgaagaccactttgattccaactttgaattagagtataacctaaaacaa
aaagggaaaactgaactcctcaaattagttgatgaaacaacttcaatcaatttgcatttt
atcagacaaagtcatccaagaggcttgggtgatgccgtcttacaagcgaaagcttttgtt
ggaaatgaaccattcatcgttatgcttggtgacgatcttatggatatcactgacaactca
gtaattcccctaacaagacaattaatgaacgacttcgagacaacccatgcgtcaacaatt
gccgttatgaaggttcctcatgaagatgtttcttcttacggggtaatcgctccgcacggt
aaagctcaccatggtttgtacagcgtttcaactttcgtagaaaaaccaaaacctgaagat
gctcctagtgatttagctatcattggacgctatctccttacccctgaaatttttgaaatc
ttagaaaatcaggcaccaggtgcaggtaacgaaatccaattgactgatgctattgataca
ttgaacaaaacgcaacgcgtctttgctcgtgaattcactgggaatcgttatgatgttggt
gataaattcggctttatgaaaacttctatcgactatgctttgaaacatgagcaagttaaa
gatgatttgaaaaaatacattatccaattaggtaaagaattggaaggaaaaacagaaaca
aaataa

DBGET integrated database retrieval system