KEGG   Streptococcus thermophilus LMG18311: stu0056Help
Entry
stu0056           CDS       T00213                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:stl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    stu0056 (ruvA)
Enzymes [BR:stl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     stu0056 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
62100..62690
Genome map
AA seq 196 aa AA seqDB search
MYDYIKGTLVKITAKHIVIETNGLGYIVTVANPYSFSDQMNQTIQVYLHQVIRDDAHLLF
GFHTEDEKEVFLKLISVSGIGPTTALAIVAVDDNQGLVAAIDNSDIKYLMKFPKIGKKTA
QQMVLDLAGKFAELPAETTNTTANQTAGNQQLDEAMEALLALGYKSTELKKVKAFFEDTN
ETAEQYIKSALKMLMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattatatcaagggcaccctagtaaaaatcacagccaaacacattgtcatagaa
acaaatggtctaggatatattgtcactgtggctaatccctacagcttttctgatcaaatg
aatcagactatccaagtgtatcttcatcaagttattagagatgatgcccacctacttttt
ggttttcatactgaagatgagaaagaagtttttcttaagttgatttctgtttctgggata
ggtccgacgactgctctagccatagtggctgtggatgataatcagggacttgttgctgct
attgataatagtgacatcaaatacctgatgaaatttccaaagattggtaaaaagactgct
caacaaatggttcttgatctggcaggaaaatttgcagagttaccagcagaaacgaccaat
actacggcaaatcagactgcaggaaatcaacagttggatgaagctatggaagctttgctt
gctcttgggtacaaatccacagagcttaagaaagtgaaagccttctttgaggataccaat
gaaacggcagagcaatatattaagtccgctcttaaaatgttgatgaagtga

DBGET integrated database retrieval system