KEGG   Streptococcus thermophilus LMG18311: stu0394Help
Entry
stu0394           CDS       T00213                                 

Gene name
luxS
Definition
S-ribosylhomocysteinase
Orthology
K07173  
S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:stl01230]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:stl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(382627..383109)
Genome map
AA seq 160 aa AA seqDB search
MPKDVTVESFELDHTIVKAPYVRLISEEVGPKGDIITNFDIRLIQPNENSIDTGGLHTIE
HLLAKLIRQRIDGLIDCSPFGCRTGFHMIMWGKQDPTEIAKVIKSSLEAIANEITWEDVP
GTTIESCGNYKDHSLHSAKEWAKLILEQGISDQAFERHTV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagacgttactgttgaaagttttgaacttgatcacaccattgtaaaagcacct
tatgtccgtcttatttcagaggaagttggacctaaaggagatatcatcacaaactttgat
atccgtttgattcaacctaatgaaaatagtattgatacaggtggtcttcatactatcgaa
cacctactcgctaaactgatccgtcaacgtatcgatggccttattgattgctcaccattt
ggttgtcgtacaggttttcatatgatcatgtggggaaaacaagatcctacggaaattgcc
aaagttatcaaatctagtcttgaagctattgcaaacgaaattacttgggaagatgttcca
ggaactactattgaatcttgtggtaactataaggatcacagccttcattcagctaaggaa
tgggctaaacttatccttgaacaaggcatctcagaccaagccttcgaacgtcataccgtc
taa

DBGET integrated database retrieval system