KEGG   Streptococcus thermophilus LMG18311: stu0394Help
Entry
stu0394           CDS       T00213                                 

Gene name
luxS
Definition
S-ribosylhomocysteinase
Orthology
K07173  
S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    stu0394 (luxS)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    stu0394 (luxS)
Enzymes [BR:stl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     stu0394 (luxS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(382627..383109)
Genome map
AA seq 160 aa AA seqDB search
MPKDVTVESFELDHTIVKAPYVRLISEEVGPKGDIITNFDIRLIQPNENSIDTGGLHTIE
HLLAKLIRQRIDGLIDCSPFGCRTGFHMIMWGKQDPTEIAKVIKSSLEAIANEITWEDVP
GTTIESCGNYKDHSLHSAKEWAKLILEQGISDQAFERHTV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagacgttactgttgaaagttttgaacttgatcacaccattgtaaaagcacct
tatgtccgtcttatttcagaggaagttggacctaaaggagatatcatcacaaactttgat
atccgtttgattcaacctaatgaaaatagtattgatacaggtggtcttcatactatcgaa
cacctactcgctaaactgatccgtcaacgtatcgatggccttattgattgctcaccattt
ggttgtcgtacaggttttcatatgatcatgtggggaaaacaagatcctacggaaattgcc
aaagttatcaaatctagtcttgaagctattgcaaacgaaattacttgggaagatgttcca
ggaactactattgaatcttgtggtaactataaggatcacagccttcattcagctaaggaa
tgggctaaacttatccttgaacaaggcatctcagaccaagccttcgaacgtcataccgtc
taa

DBGET integrated database retrieval system