KEGG   Streptococcus thermophilus LMG18311: stu0579Help
Entry
stu0579           CDS       T00213                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:stl00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:stl00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
549875..550378
Genome map
AA seq 167 aa AA seqDB search
MSKQIIAIWAEARNHVIGKNHTMPWHLPAELAHFKKTTMGSAILMGRVTFDGMNRRCLPG
RETLILTRDKDFDCEEVTTVTSVEEALAWFEQQDKDLYIAGGASVYKAFDGHYDVLIKTT
IEADLEGDTYFPQLDTTAFKEVSRNRVPKNEKNAYDFSISRYEKERD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaacaaatcattgctatttgggcggaagctcgtaaccatgttattgggaagaat
cacaccatgccgtggcacttgcctgctgaactggcacatttcaagaaaacgactatgggt
tcagcaattcttatgggacgtgtgacctttgatggcatgaaccgtcgttgcctcccagga
cgtgaaaccttaattctaacacgagacaaggacttcgactgtgaggaagtaacgaccgtt
acgagtgttgaggaagctctagcttggtttgaacagcaagataaggatctctatattgct
ggtggtgctagtgtctacaaggcttttgatggacattatgatgtgctcatcaaaacaact
attgaggctgatttagagggagacacatattttccacaactagatacgacggcatttaaa
gaggtatcgcgtaaccgcgtgcccaagaatgaaaaaaatgcctatgactttagtataagt
cgctatgaaaaagaaagggactag

DBGET integrated database retrieval system