KEGG   Streptococcus thermophilus LMG 18311: stu0614Help
Entry
stu0614           CDS       T00213                                 

Gene name
recR
Definition
(GenBank) recombination protein
  KO
K06187  recombination protein RecR
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:stl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    stu0614 (recR)
DNA repair and recombination proteins [BR:stl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     stu0614 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      stu0614 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH HHH_8 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: AAV60320
UniProt: Q5M580
Position
583686..584282
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSFSKLPGIGAKTATRLAFYTISMSDEDVNDFAKNLLAAKRELTYCSVC
GRLTDDDPCIICTDETRDRTKILVVEDSKDVSAMEKIQEYRGLYHVLQGLISPMNGVGPD
DINLKSLITRLMDSEVDEVIIATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcctactccaattgctaaactgattgatagtttttcaaaacttccaggaatt
ggggctaagacggcgacacgtctggctttctataccattagcatgtctgatgaagatgtc
aatgattttgcaaaaaatcttttagcagcaaaacgtgagttgacctattgttcagtttgt
ggtcgcttgactgatgatgacccatgtattatttgtacggatgaaactagagaccgtact
aagattttggttgttgaggactccaaagatgtttctgctatggaaaagattcaggaatat
cgtggtctctaccatgtgcttcaagggcttatctcccctatgaatggtgttggaccagat
gatattaatttaaaaagtttgattacccgtcttatggatagcgaggttgacgaggtcatc
atcgcaactaatgcaacggccgatggtgaggcaacctctatgtatatttcacgggtcctc
aaacctgcaggtattaaggtgacccgcctagcgcgtgggctggctgttggttctgacatc
gagtacgctgatgaagtaaccttgctaagagccatcgagaatcgaacagaactgtag

DBGET integrated database retrieval system