KEGG   Streptococcus thermophilus LMG18311: stu0728Help
Entry
stu0728           CDS       T00213                                 

Gene name
glcK
Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    stu0728 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    stu0728 (glcK)
   00052 Galactose metabolism
    stu0728 (glcK)
   00500 Starch and sucrose metabolism
    stu0728 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    stu0728 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    stu0728 (glcK)
   00524 Butirosin and neomycin biosynthesis
    stu0728 (glcK)
Enzymes [BR:stl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     stu0728 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
686286..687254
Genome map
AA seq 322 aa AA seqDB search
MSKKLLGIDLGGTTVKFGILTADGEVQEKWAIETNTFENGSHIVPDIVESLKHRLELYGL
TAEDFIGIGMGSPGAVDRENKTVTGAFNLNWAETQEVGSVIEKELGIPFAIDNDANVAAL
GERWVGAGANNRNVVFITLGTGVGGGVIADGNLIHGVAGAGGEIGHIIVEPDTGFECTCG
NKGCLETVASATGIVRVAHHLAEKYEGNSSIKAAVDNGEFVTSKDIIVAATEGDKFADSI
VDKVSKYLGLATANISNILNPDSVVIGGGVSAAGEFLRSRVEGYFTRYAFPQVRRTTKVK
LAELGNDAGIIGAASLAYSIDK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaactcttaggtattgaccttggtggaacaactgttaagtttggtattttg
actgcagatggtgaagttcaagaaaaatgggctattgaaacaaatacgtttgaaaatggt
agccacattgttcctgacattgtagaatctttgaaacaccgtttggaattgtatggactt
actgctgaagattttattggaattggtatgggatctccaggtgcagttgaccgagaaaat
aaaacagtaacgggtgcctttaacttgaactgggcagaaactcaagaagttggctctgtt
attgaaaaagaacttggtattccattcgctattgataatgatgctaatgtggctgcactg
ggtgaacgttgggttggtgctggtgctaacaatcggaatgttgtctttataacattgggt
acaggtgttggtggcggtgttatcgctgatggtaacttaattcatggtgttgccggtgct
ggtggggaaattggtcacattattgttgaacctgacacaggatttgagtgtacttgcgga
aacaaggggtgtctggaaactgtagcttcagcaacaggtattgtacgtgtagcacatcat
ttggcagaaaaatacgaaggaaactcttctattaaagctgctgtagacaatggtgagttt
gtgacaagtaaagatattatcgtagctgctactgaaggtgataagtttgctgacagcatt
gttgataaagtctctaaatacctcggacttgcaacagcaaacatctcaaacattcttaac
ccagattctgtcgttatcggtggtggtgtttctgccgcaggagaattcttgcgtagtcgt
gttgaaggatactttacacgttatgcattcccacaagttcgccgtacaacaaaagtgaaa
ttagcggagcttggaaatgatgcaggaatcattggagctgctagtcttgcttatagtatt
gacaaataa

DBGET integrated database retrieval system