KEGG   Streptococcus thermophilus LMG18311: stu0735Help
Entry
stu0735           CDS       T00213                                 

Gene name
ftsZ
Definition
(GenBank) cell division protein
  KO
K03531  
cell division protein FtsZ
Organism
stl  Streptococcus thermophilus LMG18311
Brite
Chromosome [BR:stl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    stu0735 (ftsZ)
Cytoskeleton proteins [BR:stl04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   stu0735 (ftsZ)
Prokaryotic defense system [BR:stl02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    stu0735 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
694747..696069
Genome map
AA seq 440 aa AA seqDB search
MSFSFDSASVQGAVIKVIGVGGGGGNAINRMIEEGLSGVEFIAANTDIQALSSSKAETVI
QLGPKLTRGLGAGGQPEVGRKAAEESEETLTEALTGADMVFITAGMGGGSGTGAAPVIAR
IAKSLGALTVAVVTRPFGFEGNKRSSFAIEGIQELREQVDTLLIISNNNLLEIVDKKTPL
LEALSEADNVLRQGVQGITDLITNPGLINLDFADVKTVMANKGNALMGIGIGSGEERIVE
AARKAIYSPLLETTIDGAEDVIVNVTGGLDMTLTEAEEASEIVGQAAGNGVNIWLGTSID
DTLKDEIRVTVVATGVRQERAEKVSGMKAQPRKVTTAPSQSSVPNQQVAQEQQRLGSQAS
FERQPNFDYNETHSMSQPGVRPTMAAPQQEQSAFGNWDLRRDNISRPKTGELDSQLTMST
FSSDVEDDDELETPPFFKNR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttcatttgatagcgcatcagttcagggtgcggtaattaaagttattggtgtc
ggtggaggtggaggaaatgccatcaaccgaatgattgaagaaggtctttctggtgttgaa
tttattgcagctaacacggatattcaagcgctcagctcttctaaagcagaaacagttatc
caattaggtcctaaattgactcgtggtcttggtgctggaggtcaacctgaagttggtcgt
aaagcagctgaagaaagtgaagaaacacttacagaggcacttacaggagctgatatggta
tttatcactgctggtatgggtggtggttctggtacaggggcagcaccagttattgcacgt
attgcgaaaagcttgggtgcattgacagtagcagtggttacgcgtccatttggatttgaa
ggtaataagcgtagttccttcgctattgaaggtattcaagaattgcgtgaacaagttgat
actcttcttattatctctaacaacaaccttcttgaaatcgttgataagaaaactccactt
cttgaagcccttagtgaagcagataatgtcctacgccaaggggtacaaggtattacagac
cttattaccaacccaggtttaatcaacctcgactttgctgatgtgaaaacagttatggca
aataaaggcaatgcgcttatggggattggtattggttctggtgaagaacgtattgttgaa
gctgcacgcaaagcaatctattcaccgcttcttgaaacaactatcgatggtgcagaagat
gttatcgttaacgtaactggtggccttgatatgacacttacagaggcagaagaagcatct
gaaatcgttggtcaagctgctggtaacggtgttaatatttggcttggtacatcaatcgat
gatactttgaaagatgaaattcgtgtaacggttgttgcaacgggggttcgtcaagagcgt
gctgaaaaggtatctggtatgaaagctcaaccacgcaaagtgactacagctccttcacaa
tcgtcagttcctaatcagcaagttgctcaagaacaacaacgtctaggttctcaagcttca
tttgaacgtcaaccgaatttcgactacaatgaaacacattcaatgtcacaaccaggcgtt
cgtccaactatggcagcacctcaacaagagcaatcagcttttggaaactgggacttgaga
cgtgataatatttctcgtcctaagacaggtgaacttgatagtcaattgactatgtctaca
ttctcaagtgatgttgaagatgacgatgaattggagacaccaccattctttaaaaaccgt
taa

DBGET integrated database retrieval system