KEGG   Streptococcus thermophilus LMG18311: stu0818Help
Entry
stu0818           CDS       T00213                                 

Gene name
asnC
Definition
asparaginyl-tRNA synthetase (EC:6.1.1.22)
Orthology
K01893  
asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:stl00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    stu0818 (asnC)
Enzymes [BR:stl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     stu0818 (asnC)
Amino acid related enzymes [BR:stl01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   stu0818 (asnC)
Transfer RNA biogenesis [BR:stl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    stu0818 (asnC)
 Prokaryotic Type
    stu0818 (asnC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
758237..759583
Genome map
AA seq 448 aa AA seqDB search
MSKQLVSIIDVPKHIGEEITIGAWVANKSGKGKIAFLQLRDGTAFFQGVAFKPNFIEKFG
EEEGLEKFDTIKHLSQETSIYVTGMVKEDERSKFGYELDITDIEVIGKSQDYPITPKEHG
TDFLMDNRHLWLRSRKQMAIQQIRNAIIYATYDFFDKNGFIKFDSPILSSNAAEDSTELF
ETDYFGTPAFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFL
SHDESLDLQEAYVKALIQGAIDRAPQALEILERDVDLLKKYIAEPFKRVSYDEAIDLLQA
HENDEDTDYEHLEHGDDFGSPHETWISNYFGVPTFVVNYPASFKAFYMKPVPGNPERVLC
ADLLAPEGYGEIIGGSMREDDYDALVAKMEELGMDRSEYEFYLDLRKYGSVPHGGFGIGI
ERMVTFVAGTKHIREAIPFPRMLHRIKP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaattagtttcaattattgatgtacctaaacacatcggtgaagaaatcact
atcggggcttgggttgctaacaaatcaggaaaaggtaaaattgctttcttgcaattgcgt
gatggaacagcctttttccaaggggttgctttcaaaccaaactttatcgaaaaatttggt
gaagaagaaggccttgaaaaatttgatactatcaaacaccttagccaagaaacatctatc
tacgtaactgggatggtcaaagaagatgaacgttcaaaatttggttatgaattggatatt
actgatattgaagttatcggtaagtcccaagactacccaattactccaaaagaacacggt
actgactttttgatggataatcgtcacctctggttgcgttcacgtaagcaaatggctatc
caacaaattcgtaatgccattatctatgcaacttatgatttctttgataaaaatggcttc
atcaaatttgatagtcctatcttgtctagtaatgctgctgaagattcaacagaattgttt
gagacagactactttggtacacctgctttcttgagccaatctggtcagctttatcttgag
gctggtgctatggctcttggtcgtgtcttcgactttggtcctgttttccgtgctgaaaaa
tcaaaaacacgtcgtcacttgactgagttttggatgatggacgctgagtattcattcttg
tcacatgatgagtctcttgacttgcaagaagcatatgtcaaagctcttatccaaggtgct
attgatcgtgcaccacaagctcttgaaattcttgaacgtgacgtagatcttcttaagaaa
tacattgctgagccattcaaacgtgtatcttatgatgaagcaattgatcttcttcaagcc
catgaaaatgatgaagatacagattacgagcacctcgaacatggggatgacttcggttca
ccgcacgaaacttggatttcaaactattttggtgttccaacattcgtcgttaattaccca
gcaagctttaaggccttctacatgaaacctgttcctggtaatccagagcgcgttctttgt
gcagaccttttggctccagaaggttatggtgaaatcattggtggttcaatgcgtgaagat
gattacgatgcccttgtagcaaaaatggaagaactcggaatggatcgttcagaatacgaa
ttctaccttgaccttcgtaaatatggttcggtaccacacggtggttttggtatcggtatt
gaacgtatggttactttcgtagctggcacaaaacacatccgtgaagctattccattccca
cgtatgttgcaccgtatcaaaccataa

DBGET integrated database retrieval system