KEGG   Streptococcus thermophilus LMG18311: stu0818Help
Entry
stu0818           CDS       T00213                                 

Gene name
asnC
Definition
asparaginyl-tRNA synthetase (EC:6.1.1.22)
Orthology
K01893  
asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:stl00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
758237..759583
Genome map
AA seq 448 aa AA seqDB search
MSKQLVSIIDVPKHIGEEITIGAWVANKSGKGKIAFLQLRDGTAFFQGVAFKPNFIEKFG
EEEGLEKFDTIKHLSQETSIYVTGMVKEDERSKFGYELDITDIEVIGKSQDYPITPKEHG
TDFLMDNRHLWLRSRKQMAIQQIRNAIIYATYDFFDKNGFIKFDSPILSSNAAEDSTELF
ETDYFGTPAFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFL
SHDESLDLQEAYVKALIQGAIDRAPQALEILERDVDLLKKYIAEPFKRVSYDEAIDLLQA
HENDEDTDYEHLEHGDDFGSPHETWISNYFGVPTFVVNYPASFKAFYMKPVPGNPERVLC
ADLLAPEGYGEIIGGSMREDDYDALVAKMEELGMDRSEYEFYLDLRKYGSVPHGGFGIGI
ERMVTFVAGTKHIREAIPFPRMLHRIKP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaattagtttcaattattgatgtacctaaacacatcggtgaagaaatcact
atcggggcttgggttgctaacaaatcaggaaaaggtaaaattgctttcttgcaattgcgt
gatggaacagcctttttccaaggggttgctttcaaaccaaactttatcgaaaaatttggt
gaagaagaaggccttgaaaaatttgatactatcaaacaccttagccaagaaacatctatc
tacgtaactgggatggtcaaagaagatgaacgttcaaaatttggttatgaattggatatt
actgatattgaagttatcggtaagtcccaagactacccaattactccaaaagaacacggt
actgactttttgatggataatcgtcacctctggttgcgttcacgtaagcaaatggctatc
caacaaattcgtaatgccattatctatgcaacttatgatttctttgataaaaatggcttc
atcaaatttgatagtcctatcttgtctagtaatgctgctgaagattcaacagaattgttt
gagacagactactttggtacacctgctttcttgagccaatctggtcagctttatcttgag
gctggtgctatggctcttggtcgtgtcttcgactttggtcctgttttccgtgctgaaaaa
tcaaaaacacgtcgtcacttgactgagttttggatgatggacgctgagtattcattcttg
tcacatgatgagtctcttgacttgcaagaagcatatgtcaaagctcttatccaaggtgct
attgatcgtgcaccacaagctcttgaaattcttgaacgtgacgtagatcttcttaagaaa
tacattgctgagccattcaaacgtgtatcttatgatgaagcaattgatcttcttcaagcc
catgaaaatgatgaagatacagattacgagcacctcgaacatggggatgacttcggttca
ccgcacgaaacttggatttcaaactattttggtgttccaacattcgtcgttaattaccca
gcaagctttaaggccttctacatgaaacctgttcctggtaatccagagcgcgttctttgt
gcagaccttttggctccagaaggttatggtgaaatcattggtggttcaatgcgtgaagat
gattacgatgcccttgtagcaaaaatggaagaactcggaatggatcgttcagaatacgaa
ttctaccttgaccttcgtaaatatggttcggtaccacacggtggttttggtatcggtatt
gaacgtatggttactttcgtagctggcacaaaacacatccgtgaagctattccattccca
cgtatgttgcaccgtatcaaaccataa

DBGET integrated database retrieval system