KEGG   Streptococcus thermophilus LMG18311: stu0882Help
Entry
stu0882           CDS       T00213                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    stu0882
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    stu0882
  Lipid metabolism
   00071 Fatty acid degradation
    stu0882
  Amino acid metabolism
   00350 Tyrosine metabolism
    stu0882
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    stu0882
   00626 Naphthalene degradation
    stu0882
Enzymes [BR:stl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     stu0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
802726..803214
Genome map
AA seq 162 aa AA seqDB search
MAIQYAKKVFNTRVVAVDINQDKLYLAKESGADLVVNGKEVEDVAGYIQEKTGGTHSAVV
TAVSKVAFNQAVDRVRAGGTVVAVGLPSEYMELSIVKTVLDGIRVVGSLVGTRKDLEEAF
DFGAQGLVVPVVETVPVDTAVKVFDQMEKGEIQGRKVVDFTK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
ttggctattcaatatgctaagaaagtttttaacacacgagtagtagcagttgatatcaat
caagataaactatatttagctaaagaatctggcgctgatttagtggtaaatggtaaagaa
gttgaagatgtagctggctatatccaagagaaaactggtggtacacacagtgctgttgta
acagctgtttctaaggttgctttcaaccaggctgtcgatagagtacgtgccggtggtacg
gtcgttgccgttgggcttccatctgaatacatggagctctcaattgtcaaaacagttcta
gatggtatccgtgttgttggatctcttgtaggtacgcgtaaagacttagaagaagctttt
gacttcggtgcacaaggcttggtagtaccagttgttgaaaccgttcctgtcgatacagct
gtaaaagtatttgatcaaatggaaaaaggtgaaattcaaggacgtaaggtagttgatttc
actaagtaa

DBGET integrated database retrieval system