KEGG   Streptococcus thermophilus LMG 18311: stu0882Help
Entry
stu0882           CDS       T00213                                 

Definition
(GenBank) alcohol dehydrogenase I, truncated
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00010  Glycolysis / Gluconeogenesis
stl00625  Chloroalkane and chloroalkene degradation
stl00626  Naphthalene degradation
stl01100  Metabolic pathways
stl01110  Biosynthesis of secondary metabolites
stl01120  Microbial metabolism in diverse environments
stl01130  Biosynthesis of antibiotics
stl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    stu0882
  Lipid metabolism
   00071 Fatty acid degradation
    stu0882
  Amino acid metabolism
   00350 Tyrosine metabolism
    stu0882
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    stu0882
   00626 Naphthalene degradation
    stu0882
Enzymes [BR:stl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     stu0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AAV60550
Position
802726..803214
Genome map
AA seq 162 aa AA seqDB search
MAIQYAKKVFNTRVVAVDINQDKLYLAKESGADLVVNGKEVEDVAGYIQEKTGGTHSAVV
TAVSKVAFNQAVDRVRAGGTVVAVGLPSEYMELSIVKTVLDGIRVVGSLVGTRKDLEEAF
DFGAQGLVVPVVETVPVDTAVKVFDQMEKGEIQGRKVVDFTK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
ttggctattcaatatgctaagaaagtttttaacacacgagtagtagcagttgatatcaat
caagataaactatatttagctaaagaatctggcgctgatttagtggtaaatggtaaagaa
gttgaagatgtagctggctatatccaagagaaaactggtggtacacacagtgctgttgta
acagctgtttctaaggttgctttcaaccaggctgtcgatagagtacgtgccggtggtacg
gtcgttgccgttgggcttccatctgaatacatggagctctcaattgtcaaaacagttcta
gatggtatccgtgttgttggatctcttgtaggtacgcgtaaagacttagaagaagctttt
gacttcggtgcacaaggcttggtagtaccagttgttgaaaccgttcctgtcgatacagct
gtaaaagtatttgatcaaatggaaaaaggtgaaattcaaggacgtaaggtagttgatttc
actaagtaa

DBGET integrated database retrieval system