KEGG   Streptococcus thermophilus LMG18311: stu0921Help
Entry
stu0921           CDS       T00213                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:stl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
838086..838829
Genome map
AA seq 247 aa AA seqDB search
MKILSIIYDGGSRIPGARFAPTKYYQEAMLYDRKDSDIITINLGNQDLFSIDLESLSRTI
AESKVQIALGGDHSVTYLLAKATVREGAYLIVLDAHLDYFKDFESVVKNWNFLSFLTDIF
EKIIIIGERNFEFPSSFDNKIIILSMEEYWLNKSRVLKKLDSYIDESKDIYLSIDIDVLD
PSVFDSVSYPIIGGFQMNDFLGIISKILCSDKVYFCDIVEYNPMVGSDNAHIFYQMIQFV
KSKLRRI
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattatctattatttatgatggtggaagtagaattccaggagcgagatttgct
cccacaaaatattatcaagaagcgatgttatatgataggaaagattctgatataattaca
attaatttaggtaatcaagatttattttctattgatttagaaagtctaagtcgaactatt
gctgaatctaaagttcagattgctttaggaggagatcattcagttacttatctattagca
aaggccactgttcgagagggagcatatttaattgttttagatgctcatttagattacttc
aaagactttgaaagtgttgtaaaaaattggaattttttaagttttttaaccgatattttt
gaaaaaataattatcattggggaaaggaattttgagtttcctagttcatttgataataaa
ataatcatcctctcaatggaggagtattggttaaataagagtagagttttgaaaaagtta
gatagttatattgatgagtcaaaagatatttacttatcaatagacattgatgttttggat
ccatctgtttttgattcagtatcatatcctattattggaggatttcaaatgaacgatttt
cttggaataatttccaaaattttatgttctgataaggtatatttttgtgatatagttgag
tacaatccgatggttggaagtgataatgctcacattttttaccaaatgattcaatttgtt
aaatcaaaattaaggaggatatag

DBGET integrated database retrieval system