KEGG   Streptococcus thermophilus LMG 18311: stu0936Help
Entry
stu0936           CDS       T00213                                 

Gene name
adhB
Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00010  Glycolysis / Gluconeogenesis
stl00625  Chloroalkane and chloroalkene degradation
stl00626  Naphthalene degradation
stl01100  Metabolic pathways
stl01110  Biosynthesis of secondary metabolites
stl01120  Microbial metabolism in diverse environments
stl01130  Biosynthesis of antibiotics
stl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    stu0936 (adhB)
  Lipid metabolism
   00071 Fatty acid degradation
    stu0936 (adhB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    stu0936 (adhB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    stu0936 (adhB)
   00626 Naphthalene degradation
    stu0936 (adhB)
Enzymes [BR:stl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     stu0936 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Sacchrp_dh_NADP Shikimate_DH PK_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AAV60601
UniProt: Q5M4K4
Position
849218..850255
Genome map
AA seq 345 aa AA seqDB search
MKSAVYTKAGQVGLAEIDRPQIVAADDAIIKIVRTCVCGSDLWSYRNPEMEEGHRNSGHE
AIGIVEEVGEQVTTVKPGDFVIAPFTHGCGQCDACRAGFDGSCDNHSGNNWSEGVQAEYI
RFHFANWALVKILGQPSDYSEGMLKSLLTLADVMPTGYHAARVANVQKGDKVVVIGDGAV
GQCAVIASKMRGASQIVLMSRHEDRQKMALESGATAVVAERGEKGIDKVREVLGGGADAA
LECVGTEAAVEQALGVLHNGGRMGFVGVPHYNNRSLGSTFAQNILVAGGVASVTTYDKQV
LLKAVLDGDINPGRVFTTSYKLEDINQAYKDMDERKSIKSMIVLD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcagtttataccaaagctggacaagtggggctggcagaaattgatcgcccg
caaatcgtggcagcagatgatgccattatcaagatagtacgtacttgcgtttgtggatct
gacctttggagttaccgtaatccggaaatggaagagggacatagaaatagtggtcatgag
gctatcggaattgtcgaagaagttggtgagcaagttactacggtaaaaccaggagacttt
gtcattgcacctttcacacatgggtgtggtcagtgtgatgcttgtcgagctggttttgac
ggctcttgtgataaccactcaggtaataactggtctgagggcgtgcaggctgagtatatc
cgtttccactttgccaactgggcccttgtcaaaattcttgggcaaccctcagattatagc
gaaggcatgctcaagtcacttttgacacttgctgatgttatgccgacgggttaccatgct
gcgcgtgtggctaatgtacaaaagggtgataaggttgtcgttatcggagatggggctgtt
ggtcaatgtgctgtcattgcatctaagatgcgtggagcttctcaaattgtccttatgagc
cgtcacgaagatcgtcaaaagatggctttggagtcaggtgcgactgcggttgtagctgag
cgtggcgaaaaaggcattgacaaagtccgtgaagtcctcgggggaggagcagatgcagct
ctcgaatgtgtcggtactgaagcagcagtagaacaagctcttggtgtcctccataacggt
ggtcgtatgggatttgtcggtgtgcctcattataataaccgttcccttggttcgaccttt
gcccaaaatattttagtggcgggaggggtagcctctgtcacaacctatgataaacaagtt
ttgttaaaagctgttcttgatggcgacatcaatccaggccgagtctttacgacaagttat
aaattggaagatattaatcaggcttataaagatatggatgaacgcaagtctattaaatct
atgattgttttagattag

DBGET integrated database retrieval system