KEGG   Streptococcus thermophilus LMG18311: stu0936Help
Entry
stu0936           CDS       T00213                                 

Gene name
adhB
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:stl01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stl00010]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:stl00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:stl00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:stl00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
849218..850255
Genome map
AA seq 345 aa AA seqDB search
MKSAVYTKAGQVGLAEIDRPQIVAADDAIIKIVRTCVCGSDLWSYRNPEMEEGHRNSGHE
AIGIVEEVGEQVTTVKPGDFVIAPFTHGCGQCDACRAGFDGSCDNHSGNNWSEGVQAEYI
RFHFANWALVKILGQPSDYSEGMLKSLLTLADVMPTGYHAARVANVQKGDKVVVIGDGAV
GQCAVIASKMRGASQIVLMSRHEDRQKMALESGATAVVAERGEKGIDKVREVLGGGADAA
LECVGTEAAVEQALGVLHNGGRMGFVGVPHYNNRSLGSTFAQNILVAGGVASVTTYDKQV
LLKAVLDGDINPGRVFTTSYKLEDINQAYKDMDERKSIKSMIVLD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcagtttataccaaagctggacaagtggggctggcagaaattgatcgcccg
caaatcgtggcagcagatgatgccattatcaagatagtacgtacttgcgtttgtggatct
gacctttggagttaccgtaatccggaaatggaagagggacatagaaatagtggtcatgag
gctatcggaattgtcgaagaagttggtgagcaagttactacggtaaaaccaggagacttt
gtcattgcacctttcacacatgggtgtggtcagtgtgatgcttgtcgagctggttttgac
ggctcttgtgataaccactcaggtaataactggtctgagggcgtgcaggctgagtatatc
cgtttccactttgccaactgggcccttgtcaaaattcttgggcaaccctcagattatagc
gaaggcatgctcaagtcacttttgacacttgctgatgttatgccgacgggttaccatgct
gcgcgtgtggctaatgtacaaaagggtgataaggttgtcgttatcggagatggggctgtt
ggtcaatgtgctgtcattgcatctaagatgcgtggagcttctcaaattgtccttatgagc
cgtcacgaagatcgtcaaaagatggctttggagtcaggtgcgactgcggttgtagctgag
cgtggcgaaaaaggcattgacaaagtccgtgaagtcctcgggggaggagcagatgcagct
ctcgaatgtgtcggtactgaagcagcagtagaacaagctcttggtgtcctccataacggt
ggtcgtatgggatttgtcggtgtgcctcattataataaccgttcccttggttcgaccttt
gcccaaaatattttagtggcgggaggggtagcctctgtcacaacctatgataaacaagtt
ttgttaaaagctgttcttgatggcgacatcaatccaggccgagtctttacgacaagttat
aaattggaagatattaatcaggcttataaagatatggatgaacgcaagtctattaaatct
atgattgttttagattag

DBGET integrated database retrieval system