KEGG   Streptococcus thermophilus LMG18311: stu1013Help
Entry
stu1013           CDS       T00213                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    stu1013 (malQ)
Enzymes [BR:stl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     stu1013 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(912271..913779)
Genome map
AA seq 502 aa AA seqDB search
MNIRASGVLMHITSLPGDYGIGSFGQAAYDFVDFLKETKQTYWQILPLTTTSYGDSPYQS
FSAIAGNTHFIDLDFLIRDGFLTEADVEGSDFGSDPEFIDYAKVYEARRPLLEKAVKAIL
ADENEAKKFETFKAENANWLADYADFMAIKEYFGNKALQDWDDKKAIKRDKATLEKLRKE
LTGVITYHQVVQYLFFSQWAELKSYANKNGIQIIGDMPIYVSADSVEVWTQPHLFKLDAE
CKPRYIAGVPPDNFSPTGQLWGNPIYDWDKHKAENYAWWVFRIQESFKLFDCLRIDHFKG
FSDFWEIPAGDETAENGKWVPGPGYDLFKVVKEELGDLKIIAEDLGNIDDKTRKLLADCG
YPGMKILHFGFYDTTGNSIYVPHAYTQHSVAYTGTHDNEVTNGWYNNLTQEQRDYTDAYI
NRRQGEPITRALLRTLFATVSNTAIATMQDILDKNENSRKNIPNTVGGNWRWRMLPGEIT
VDKKEFLTDITERYNRGNRGNK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacgagcaagcggtgttttaatgcacatcacatcacttccaggtgactacgga
atcggatctttcggtcaagcagcctacgactttgttgatttcttgaaagaaacaaagcaa
acatactggcaaattttgccattgactactacaagttatggagattcaccttaccaatca
ttctcagcaatagcgggaaatactcactttatcgatttggatttccttattcgtgacgga
ttcctgactgaagcagatgttgaaggttctgattttggttcagatccagagtttatcgac
tacgctaaagtttacgaagcacgacgcccacttcttgaaaaagcagtcaaagcaatcttg
gcagatgaaaacgaagctaagaagtttgaaactttcaaagctgaaaatgctaactggttg
gcagattatgctgacttcatggctatcaaagaatactttggtaacaaagcccttcaagat
tgggatgataaaaaagcgattaaacgtgacaaagcaactcttgaaaagcttcgcaaagaa
cttactggtgttatcacataccatcaagttgtgcaatatctcttctttagccaatgggca
gagttgaaatcctatgctaataagaacggtattcaaattattggtgatatgccaatctac
gtttcagctgatagtgtggaagtctggactcaaccacaccttttcaaattagatgctgaa
tgtaagccacgttacattgccggagttccaccagataacttctcaccaacaggacaactt
tgggggaatccaatttatgattgggataaacacaaagcagaaaactatgcttggtgggtc
ttccgtattcaagaatcattcaaactttttgattgcttgcgtatcgaccacttcaaaggt
ttctctgatttctgggaaattcctgctggagatgaaactgctgaaaatggtaaatgggtt
ccaggacctggttatgacctcttcaaagtggttaaagaagagttgggtgatcttaagatt
attgccgaagatcttggtaatattgatgataagacacgtaaacttcttgcagactgtggt
tacccaggaatgaagattcttcactttggtttctatgataccaccggtaacagcatttat
gttccacacgcatacacacaacactcagtggcttacactggtacacatgataatgaagtt
actaatggttggtataataacttgacacaagagcaacgtgattacactgatgcttatatc
aaccgtcgtcaaggtgaaccaatcacacgtgcccttcttcgcacactcttcgcaacagta
agtaacacagctattgcgactatgcaagatattcttgataaaaatgaaaatagccgtaaa
aacatccctaacacagttggaggaaactggagatggcgtatgcttccaggtgaaatcacc
gttgataaaaaagaatttttgactgatattacagaaagatataatcgaggaaatcgagga
aataaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system