KEGG   Streptococcus thermophilus LMG18311: stu1064Help
Entry
stu1064           CDS       T00213                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(952735..952965)
Genome map
AA seq 76 aa AA seqDB search
MIQVGEALQDGVELLGYTTWGPIDLVSASTAELSKRYGFIYVDRNDDGSGSLARYKKNSF
AWYKSVIESNGAALCK
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
ttgattcaagttggtgaagctcttcaagatggagtagaacttttgggctacacgacttgg
ggaccaattgatttggtttcagcctcgactgcagaacttagtaaacgttatggtttcatc
tacgttgatcgaaatgatgatggtagtggtagcttggcacgttataagaaaaattcattt
gcttggtataagtctgttatcgaaagtaatggtgccgccctttgtaaatag

DBGET integrated database retrieval system