KEGG   Streptococcus thermophilus LMG18311: stu1067Help
Entry
stu1067           CDS       T00213                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    stu1067
Enzymes [BR:stl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     stu1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(953806..954003)
Genome map
AA seq 65 aa AA seqDB search
MSLLKPLTTEEATPANLKLEGIDFYHRYKEDIALFAELGFKVFRISIAWSRIFPNGDDAE
PNEAG
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccttttgaagcctttgactactgaagaagcaacaccagctaatctaaagcttgaa
ggtatagatttctatcaccgctataaagaggatattgcgctatttgcagagctgggcttc
aaggtctttcgcatatcgattgcttggtctcgtattttcccgaacggtgatgatgctgag
ccaaatgaagcagggtag

DBGET integrated database retrieval system