KEGG   Streptococcus thermophilus LMG18311: stu1127Help
Entry
stu1127           CDS       T00213                                 

Gene name
pepV
Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    stu1127 (pepV)
  Amino acid metabolism
   00300 Lysine biosynthesis
    stu1127 (pepV)
Enzymes [BR:stl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     stu1127 (pepV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(992931..994337)
Genome map
AA seq 468 aa AA seqDB search
MTIDFHAEVDKRKEALMEDLFGLLRINSERDDSKADEKHPFGPGPVKALEYFLALAERDG
YKTRNIDNYAGDFEFGQGDEVLGIFAHLDVVPAGSGWDTDPYEPVIKEGKLYARGSSDDK
GPTMACYYALKIIKELDLPVSKRVRFIVGTDEESGWGDMDYYFAHNGLKDPDFGFSPDAE
FPIINGEKGNITAYLHFEGQNDGDFSLVSFNGGLRENMVPESASAEFTAPITLQELESKL
NDFVADQAVTGQVTEEAGVFHVTIHGKSAHGMMPQNGINGATYLALFLSQFDFKANAKTY
LDLIAETLHQDFFSEKTGLAYTDSKMGELTMNAGVFTFNKESEDNTIALNFRYPQGVNVD
GIKAGLEKLEGPKAVSLSEHGHVPHYVPVSDPMVQTLLSVYEKQTGLKGHEQIIGGGTFG
RLLKRGVAYGAMFPGYVNTMHQANEFTEVEDLYRAAAIYAEAIYELIK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgattttcacgccgaagttgataaacgtaaagaagctttgatggaggacctt
tttggtcttttgcgtattaattcagagcgtgatgatagtaaggctgatgaaaagcaccca
tttggtcctggaccagtgaaagctctagaatattttcttgctttagctgaacgtgatggt
tataagactcgtaatattgataattacgctggtgactttgaatttggtcaaggtgatgaa
gtcttgggtatttttgcacacttggatgtggttccagcgggtagcggatgggacactgat
ccttatgaaccagtaatcaaagaaggaaagctttatgcccgtggttcatcagatgataaa
gggccaacaatggcttgttattatgctttgaaaattatcaaagagcttgatcttccagta
tctaagcgtgttcgctttattgttggtacagatgaagaatctggttggggtgatatggat
tattacttcgctcataatggattgaaagatcctgattttggcttttctcctgatgcagaa
tttccaattatcaatggggaaaaaggaaatattactgcctatcttcattttgaaggacaa
aatgatggtgactttagcctcgtaagctttaatggtggcttgcgtgaaaatatggtccct
gaatctgcaagtgcagagtttacggcacctatcactttacaggaacttgagtctaaactt
aatgactttgttgctgatcaagcagtaaccggtcaagtgactgaagaagcaggtgttttc
catgtgactattcatggtaaatcagctcatggtatgatgcctcaaaatggtatcaatggg
gcaacatacttagcactcttccttagccaatttgacttcaaagctaatgctaagacttat
ttggatttaattgctgaaacacttcatcaagatttcttttctgaaaagacaggtcttgcc
tatacagattctaaaatgggtgagttaactatgaatgcaggtgtctttacctttaacaag
gaatctgaagataataccattgctttgaacttccgctaccctcaaggggttaatgtagat
ggtattaaggctggccttgaaaaacttgaaggacctaaggcggtcagtctttcagaacat
ggtcatgtgccgcattacgtaccagttagtgatcctatggtacagacacttctttcggtt
tatgagaaacagacaggtcttaaaggtcatgaacaaatcattggtggtggtacctttgga
cgtctccttaaacgtggtgttgcttatggtgctatgttccctggttatgtcaataccatg
caccaagcaaatgaatttactgaagttgaggacttataccgtgcagctgccatttatgca
gaagctatctatgagttgatcaagtaa

DBGET integrated database retrieval system