KEGG   Streptococcus thermophilus LMG18311: stu1254Help
Entry
stu1254           CDS       T00213                                 

Definition
Mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:stl00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:stl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1102074..1103417
Genome map
AA seq 447 aa AA seqDB search
MTIKTTMGILAGKASHFVLSKLGRGSTLPGKIALKFDKDILDTLAKDYEIVVVTGTNGKT
LTTALTVGILKEAYGEIVTNPSGANMITGITSTFLTAKRAKSGKKIAVLEIDEASLPKIT
EYITPSLFVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPAATILANGDSPLFNSKELVNP
VRFYGFDTEKHAPELTHYNTEGIVCPKCESILQYHLNTYANLGDYVCLNCDFHRPELDYK
LTQLTKITNTTSEFIIDGQDYKINVGGLYNIYNALAAVSVAEFFGVVPEQIKAGFDKSRA
IFGRQETFKIGDKSCTLVLIKNPVGASQALDMIKLADYPFSLSVLLNANYADGIDTSWIW
DANFESILDMDIPEINAGGVRHSEIARRLRVTGYPEDKITQAEKLEDIMTLIEKQDCDHA
YILATYTAMLEFRDILAQRHAVGKGMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgactataaaaactactatgggtatcttggcaggtaaagctagtcactttgttctctca
aaattgggacgtggctcaaccctcccaggaaaaattgcccttaaatttgataaagatatt
ttagacacactagctaaagattatgaaatcgtcgttgtcactggtaccaacggtaagact
ctgacaactgctttgacagtcggtattctaaaagaagcttacggtgaaattgtaactaac
cctagtggagccaacatgatcactgggattacttccacctttctaactgctaaaagagct
aaatctggtaagaaaatcgctgtcttggagattgatgaagccagccttccaaaaatcact
gagtatatcactccaagtctttttgtcttcacaaatattttccgtgaccaaatggaccgt
tatggtgaaatttacaccacttatcagatgattttagatggtgctgctaaggcgccagcg
gcaactattttggctaacggggacagtcctctttttaattctaaagagctagtcaatccc
gtacgtttctacggttttgacactgaaaaacatgcgccagagcttacacactataatact
gaaggaattgtgtgtcctaagtgcgagagcattcttcagtatcaccttaatacttacgct
aacttgggtgactatgtgtgccttaactgtgacttccaccgtccagaattagattataag
ctaacgcagctgacaaaaatcaccaacaccacttctgaatttatcattgacggtcaagat
tacaagattaacgttggggggctctacaacatctataatgcccttgctgccgtttctgtc
gctgaattcttcggcgttgtgccagagcaaatcaaagctggttttgataagagtcgtgct
atctttggacgccaagaaacctttaaaattggtgataaatcatgtactctcgtactgatt
aagaatccagttggagctagccaagctctggatatgattaaacttgcagactatccattt
agcttgtcagtccttcttaatgccaactatgctgatggtattgacaccagctggatttgg
gatgccaactttgaaagcattctcgatatggatattcctgaaattaatgctggtggtgtc
cgtcactctgaaattgcccgtcgtctgcgtgtaactggctatccagaggacaaaattaca
caagcagaaaaactcgaagatattatgaccctaattgaaaagcaagactgcgaccacgcc
tatatcttagcgacctatactgccatgcttgaattccgtgatattctggcccaacgtcat
gctgtcggaaaggggatgaactaa

DBGET integrated database retrieval system