KEGG   Streptococcus thermophilus LMG 18311: stu1254Help
Entry
stu1254           CDS       T00213                                 

Definition
(GenBank) conserved hypothetical protein, Mur ligase family protein
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00300  Lysine biosynthesis
stl00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    stu1254
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    stu1254
Enzymes [BR:stl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     stu1254
Peptidoglycan biosynthesis and degradation proteins [BR:stl01011]
 Precursor biosynthesis
  Amino acid ligase
   stu1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M TF_Zn_Ribbon Zn_Tnp_IS1595 zinc_ribbon_10
Motif
Other DBs
NCBI-ProteinID: AAV60888
UniProt: Q5M3V5
Position
1102074..1103417
Genome map
AA seq 447 aa AA seqDB search
MTIKTTMGILAGKASHFVLSKLGRGSTLPGKIALKFDKDILDTLAKDYEIVVVTGTNGKT
LTTALTVGILKEAYGEIVTNPSGANMITGITSTFLTAKRAKSGKKIAVLEIDEASLPKIT
EYITPSLFVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPAATILANGDSPLFNSKELVNP
VRFYGFDTEKHAPELTHYNTEGIVCPKCESILQYHLNTYANLGDYVCLNCDFHRPELDYK
LTQLTKITNTTSEFIIDGQDYKINVGGLYNIYNALAAVSVAEFFGVVPEQIKAGFDKSRA
IFGRQETFKIGDKSCTLVLIKNPVGASQALDMIKLADYPFSLSVLLNANYADGIDTSWIW
DANFESILDMDIPEINAGGVRHSEIARRLRVTGYPEDKITQAEKLEDIMTLIEKQDCDHA
YILATYTAMLEFRDILAQRHAVGKGMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgactataaaaactactatgggtatcttggcaggtaaagctagtcactttgttctctca
aaattgggacgtggctcaaccctcccaggaaaaattgcccttaaatttgataaagatatt
ttagacacactagctaaagattatgaaatcgtcgttgtcactggtaccaacggtaagact
ctgacaactgctttgacagtcggtattctaaaagaagcttacggtgaaattgtaactaac
cctagtggagccaacatgatcactgggattacttccacctttctaactgctaaaagagct
aaatctggtaagaaaatcgctgtcttggagattgatgaagccagccttccaaaaatcact
gagtatatcactccaagtctttttgtcttcacaaatattttccgtgaccaaatggaccgt
tatggtgaaatttacaccacttatcagatgattttagatggtgctgctaaggcgccagcg
gcaactattttggctaacggggacagtcctctttttaattctaaagagctagtcaatccc
gtacgtttctacggttttgacactgaaaaacatgcgccagagcttacacactataatact
gaaggaattgtgtgtcctaagtgcgagagcattcttcagtatcaccttaatacttacgct
aacttgggtgactatgtgtgccttaactgtgacttccaccgtccagaattagattataag
ctaacgcagctgacaaaaatcaccaacaccacttctgaatttatcattgacggtcaagat
tacaagattaacgttggggggctctacaacatctataatgcccttgctgccgtttctgtc
gctgaattcttcggcgttgtgccagagcaaatcaaagctggttttgataagagtcgtgct
atctttggacgccaagaaacctttaaaattggtgataaatcatgtactctcgtactgatt
aagaatccagttggagctagccaagctctggatatgattaaacttgcagactatccattt
agcttgtcagtccttcttaatgccaactatgctgatggtattgacaccagctggatttgg
gatgccaactttgaaagcattctcgatatggatattcctgaaattaatgctggtggtgtc
cgtcactctgaaattgcccgtcgtctgcgtgtaactggctatccagaggacaaaattaca
caagcagaaaaactcgaagatattatgaccctaattgaaaagcaagactgcgaccacgcc
tatatcttagcgacctatactgccatgcttgaattccgtgatattctggcccaacgtcat
gctgtcggaaaggggatgaactaa

DBGET integrated database retrieval system