KEGG   Streptococcus thermophilus LMG 18311: stu1543Help
Entry
stu1543           CDS       T00213                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00790  Folate biosynthesis
stl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    stu1543 (folP)
Enzymes [BR:stl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     stu1543 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AAV61146
UniProt: Q5M392
Position
complement(1359577..1360377)
Genome map
AA seq 266 aa AA seqDB search
MFIGKHEIAGKACIMGILNVTPDSFSDGGDFDTIEDALAQVERMISQGASIIDVGGESTR
PGAEFVTEEEEIARIVPIIQAIKEKYDVLISIDTYKTATARAALEAGADILNDVWAGLYD
GQMLALSAEKNVPIILMHNQKEEKYNDVTENVCTFLSQRTQAALEAGVAKENIWIDPGFG
FAKNVQHNIDLLRGLDKVVGLGYPVLFGISRKRVVDFLLGGNIPAKDRDQGTAALSAYAV
SKGCQIVRVHNVEANRDVVKTISGIL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtttattggtaaacatgaaattgcaggtaaggcctgcattatgggaatcttgaatgtt
accccagactctttctcagacggtggggattttgacacaattgaagatgcattagcccag
gttgagcgtatgatttcccaaggggctagcattatcgatgtaggtggtgaatctacaaga
cctggagcggaatttgtaaccgaggaagaagagattgctcgtatagtgccaattatacaa
gctattaaggaaaaatatgatgttcttatcagtattgatacttacaagacagccactgcc
agagctgctcttgaagcaggtgcagatattcttaatgatgtctgggcaggactttatgat
ggtcagatgctagccttatcagctgaaaaaaatgtaccgattatcctcatgcataatcaa
aaagaagaaaaatacaatgatgtcacagagaatgtctgtactttccttagtcaacgtacg
caagctgccttggaagcaggtgtagctaaagaaaatatttggattgatcctggctttggt
tttgccaagaatgttcaacacaatattgacctgcttaggggcttggacaaagttgttgga
cttgggtatcctgttctttttgggatttctcgtaagcgtgttgtggattttctcctaggt
ggaaatattcctgccaaggaccgtgatcaagggacagctgctttatctgcttatgctgtt
agcaaaggatgtcagattgtccgtgtccataatgttgaagccaatcgtgatgtcgttaag
actatctcaggaattttatga

DBGET integrated database retrieval system