KEGG   Streptococcus thermophilus LMG 18311: stu1560Help
Entry
stu1560           CDS       T00213                                 

Gene name
murZ
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00520  Amino sugar and nucleotide sugar metabolism
stl00550  Peptidoglycan biosynthesis
stl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    stu1560 (murZ)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    stu1560 (murZ)
Enzymes [BR:stl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     stu1560 (murZ)
Peptidoglycan biosynthesis and degradation proteins [BR:stl01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   stu1560 (murZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AAV61163
UniProt: Q5M376
Position
complement(1377141..1378412)
Genome map
AA seq 423 aa AA seqDB search
MSSMRKIIINGGKKLQGEVTVSGAKNSVVALIPAIILSDGVVTLDGVPAISDVDNLIEII
EVMGGSVKRDGETLEIDPRGVKDMPMPFGKINSLRASYYFYGSLLGRYGQAIVGLPGGCD
LGPRPIDLHLKAFEAMGASIFYEGEAMRIATDAGQRIKGAHIYMDTVSVGATINTMLAAA
KADGRTVIENAAREPEIIDVATLLNNMGARVRGAGTEVITIEGVESLHGTRHQVIPDRIE
AGSYIAMAAAIGKGIKIKNVLYEHLESFICKLEAMGVRMTVEEDAIFVEEQGDLKPVDIK
TSPYPGFATDLQQPMTPLLLKASGRGKIIDTIYEKRVNHVPELARMGADIQVLGGQIVYN
GPTQLSGAPVKASDLRAGAALVTAGLMADGQTEITNIEFILRGYSNIIEKLSDLGADIRL
IED
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgagcagtatgcgtaaaattatcatcaatggtggtaagaaacttcaaggagaagttaca
gtatcaggagctaaaaattcagttgttgcattgattccagccatcattttatctgatgga
gtggttactcttgacggggtaccagcaatcagcgacgtcgataatctaattgagattatt
gaagtaatgggtggttctgttaagcgtgatggcgaaacacttgaaatcgaccctcgaggc
gttaaagatatgccaatgccatttggtaagattaacagccttcgtgcttcatattatttc
tatggtagtttgcttgggcgttatggtcaagctatagtaggtttgcctggtggatgtgat
ttaggaccacgtcctattgaccttcaccttaaggcctttgaagctatgggtgctagcatt
ttctatgaaggagaagctatgcgtattgctacggatgccggccaacgtattaagggtgct
cacatctatatggatacggttagtgtgggggcgactatcaataccatgttggcagcggct
aaggctgacggtcgtactgttattgaaaatgcggctcgtgaacctgagattattgatgtg
gcaacgcttctcaacaatatgggtgcgcgtgtacgtggcgctggtacagaagtcatcacg
attgagggtgtagagagcctacatggtactcgccatcaagttattccagaccgtattgaa
gcaggctcatacattgccatggcggcagctatcggtaagggaattaaaattaaaaatgtt
ctctatgaacaccttgaaagttttatttgtaagcttgaagcaatgggtgttcgcatgacc
gttgaagaggatgcaatctttgtggaagaacagggtgatttaaaacctgttgacattaag
acatcaccttatccaggttttgcgacggatttacaacaaccaatgacaccattgttgttg
aaagcaagtggccgaggaaaaatcattgatacgatctatgagaagcgtgtaaatcacgtt
cctgaactggctcgtatgggtgctgatattcaagtacttggtggtcagattgtttataat
ggtccaacgcaactttctggtgcacctgtgaaagctagtgatttgcgtgcgggtgctgca
ctcgttactgcaggacttatggcagatggtcaaactgaaataacaaacattgaatttatc
cttcggggatattcaaatatcattgagaaactttctgatcttggtgcggatattcgtttg
attgaagattaa

DBGET integrated database retrieval system