KEGG   Streptococcus thermophilus LMG18311: stu1587Help
Entry
stu1587           CDS       T00213                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    stu1587 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    stu1587 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    stu1587 (trpA)
Enzymes [BR:stl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     stu1587 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1405000..1405782)
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLQAIKDSKRGIFVPYIMAGDHAKGLDGLFETITLLENSGVSAIEVGIPWSDP
VADGPIIELAGQRSLAKDVTLTAIIKKLQEKKTQVPLVIMTYINPVYQYGIEAFVKDLAE
TSVKGLIIPDLPNEHADFITPYLRDSDIALVPLVSLTTGIDRQKQLIDGAEGFIYAVAIN
GVTGKTGNYRDDLDKHLSNLTAYADIPVLTGFGVSTEEDIKRFNAVSDGVIVGSKIVRDL
HDGKEEEVAEFVTFGSHFEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacactaacaaaacatctacaagctatcaaagacagtaaacgcggtattttc
gttccctatatcatggctggtgaccacgctaaaggtctagacggactctttgagactatt
actctcttagaaaatagcggtgtttcagctatcgaggtgggtattccatggtctgaccca
gtggctgatggtcccattattgaactagcaggacaacgtagtttggctaaagacgtgact
ttaacagctatcatcaagaagcttcaagaaaaaaagacacaggtgcctttggttatcatg
acctacatcaacccagtttatcagtatggtattgaagcctttgtcaaagatttagcagag
acttctgtcaaggggctcatcattcctgatttgccaaatgaacatgctgactttatcact
ccttatttgagagacagtgacattgctctcgtgcctttggtcagcttgactacaggcatt
gatcgtcagaaacagttgattgatggtgcagaaggctttatctacgccgttgctatcaat
ggtgttactggtaagactggtaattaccgtgatgaccttgataaacacttatctaacttg
actgcctatgcagacattccagttctcacaggttttggtgtgtcaacagaggaagacatt
aaacgctttaatgctgtgtcagacggtgttatcgtgggatcaaaaattgtccgtgacctg
cacgacggtaaggaagaagaagtcgctgaatttgttacattcggatcacattttgaaaaa
tag

DBGET integrated database retrieval system