KEGG   Streptococcus thermophilus LMG18311: stu1588Help
Entry
stu1588           CDS       T00213                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    stu1588 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    stu1588 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    stu1588 (trpB)
Enzymes [BR:stl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     stu1588 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1405786..1406994)
Genome map
AA seq 402 aa AA seqDB search
MTYQQPDAKGFYGKFGGQFVPETLMTAVIELDKAYREAKEDSSFQAELDDLLKNYVGRET
PLYHAKRLTDHIGGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMDCTIYVGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVAGIEDTHYIMGSALGPAPFPEIVRDFQSVIGREAKRQYAEISGGKLPDAVMACIGGGS
NAIGMFYPFVNDKSVAMYGAEASGLGLDTEKHAATFAKGRPGILHGALMDVLQDAHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALEGFKLLSRLEGIIPALESSHAI
ALAQKVAAKMSPDQSLIVCLSGRGDKDVMQVKERFEAEAEGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaacaacctgatgcaaaaggattttacggaaaattcggcggtcagttcgtt
cccgaaacgctgatgacagccgttattgaattggataaggcctatcgtgaagccaaagaa
gattcaagtttccaagcggaattggatgacctccttaaaaactatgttggccgtgaaaca
cctctttaccacgccaaacgtttgacagatcatatcggtggagcgcaaatttaccttaaa
cgtgaagaccttaaccacacaggggcccacaagattaacaatgccctcggtcaagtcttg
cttgctaaacgtatgggtaagaagaaaatcatcgccgaaactggtgcaggtcaacacggt
gtcgcaacagcgacagccgctgctcttttcgacatggactgtaccatctatgtgggtgag
gaagatgtgaaacgtcaggcgcttaacgttttccgtatggagttgcttggtgccaaagtt
ttcagtgttaccgatggctcacgcgtgcttaaggacgctgtaaatgctgctcttcgtgct
tgggttgcaggtatcgaggatactcactacatcatgggatctgcccttggtccagcacca
ttcccagaaattgttcgtgatttccaatctgttatcggtcgtgaagccaaacgccaatat
gcagagatttctggcgggaaactgcctgatgctgtaatggcttgtatcggtggtggttca
aatgctatcggcatgttctacccatttgtcaatgataaatcagtagctatgtatggtgct
gaggcttctggtttgggacttgatactgaaaaacacgccgcaacctttgccaaaggtcgc
ccaggtatccttcatggagcgcttatggatgtcctccaagatgctcatggtcaaataatg
gaagctttctctatctcagctggtctggactacccaggggttggtcctgagcactgttat
ttcaacgaaataggacgtgcgacttacgactctatcacagatgaagaagcgctagaagga
ttcaaacttctgtcacgtttggaaggtattatcccagctcttgagtctagccatgccatt
gcgcttgcacaaaaagtggcagctaagatgtcgccagaccaaagcctcatcgtctgcctc
tcaggtcgtggggataaggacgttatgcaggttaaagaacgttttgaagctgaagcagaa
gggaaataa

DBGET integrated database retrieval system