KEGG   Streptococcus thermophilus LMG18311: stu1631Help
Entry
stu1631           CDS       T00213                                 

Definition
(GenBank) 6-phospho-beta-glucosidase, truncated
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
stl00010  Glycolysis / Gluconeogenesis
stl00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    stu1631
   00500 Starch and sucrose metabolism
    stu1631
Enzymes [BR:stl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     stu1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 DUF3997 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AAV61234
Position
complement(1444311..1445234)
Genome map
AA seq 307 aa AA seqDB search
MVPIGEDRLSIITGRRKMFDFEDGYSYPAKESIDMYHRYKENIALFGEMGFKTYRLSIAW
SRIFPKGDEAESNEVGLAFYEDLFKECHKHSIEPLVTITHFDCPMHLITEYGGWRNRKIL
GFYENLCRTLFTRYKGLVKYWLTFNEINMILHAPFMGAGICFEEGENEEQVKYQAAHQEL
VASSMATKLAHKIDPENKVGCMLADGQYYPNTAHPRDYWAAMQEDRSNYFFIDVQDRGEY
PNYAKKQWERDGIKLEMTEEDLELLKEHTVDFIFFSSLIIQVVWLQVIQKLMKRLPAISL
PLLKIHI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggtaccgattggtgaggatcgcctttcgattattactggacgtcgcaagatgtttgat
tttgaggatggttattcttatccagctaaggaaagcattgatatgtaccaccgttacaag
gaaaatattgctctctttggtgaaatgggctttaagacttatcgactttctattgcttgg
tctcgtatttttcctaagggtgatgaggctgagtcaaatgaagttgggctagctttttac
gaggacctattcaaggaatgtcacaaacatagcatcgaacccttagtaactattacgcac
tttgattgtccaatgcacttgattacagagtatggtggatggcgtaatcgtaagattctt
ggtttctatgaaaatctttgccgtacccttttcacacgttataaaggtttggttaagtac
tggctcacttttaacgaaattaacatgattctccatgcaccatttatgggagcagggatc
tgttttgaagagggtgagaatgaggagcaggttaaataccaagcagctcaccaagagttg
gtagcttcatctatggcgactaagttggctcacaagattgatcctgaaaataaggttggt
tgtatgttggcagacggtcagtattatccaaatacagcccacccacgtgactactgggca
gccatgcaagaagatcggagtaactatttcttcattgatgtccaggatcgtggagagtat
ccaaattatgctaaaaagcagtgggagcgtgatggtattaagcttgagatgactgaagaa
gatttggagcttctcaaagagcatactgttgatttcattttcttctcttctcttattatt
caagtcgtgtggcttcaggtgatccagaagttaatgaaaagactgccggcaatatctttg
cccctattaaaaatccatatttag

DBGET integrated database retrieval system