KEGG   Streptococcus thermophilus LMG18311: stu1636Help
Entry
stu1636           CDS       T00213                                 

Gene name
aspC2
Definition
aminotransferase (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    stu1636 (aspC2)
   01230 Biosynthesis of amino acids
    stu1636 (aspC2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    stu1636 (aspC2)
   00290 Valine, leucine and isoleucine biosynthesis
    stu1636 (aspC2)
Enzymes [BR:stl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     stu1636 (aspC2)
    2.6.1.66  valine---pyruvate transaminase
     stu1636 (aspC2)
Amino acid related enzymes [BR:stl01007]
 Aminotransferase (transaminase)
  Class I
   stu1636 (aspC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1448651..1449865)
Genome map
AA seq 404 aa AA seqDB search
MKTFDKSSKLEHVAYDIRGPVLDEANRMIAKGEKILRLNTGNPAEFGFTAPDEVIRDLIM
NVRNSEGYSDSKGIFSARKAIMQYCQLKGFPNVDIDDIYIGNGVSEMIPMSMQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYVCDEKSNWYPDIDDIKSKITSNTKAIVIINPNNP
TGALYPKDVLEQIVDIARQNDLIIFADEIYDRLVMDGKKHIAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKKNVRGYIEGLDMLSNMRLCSNVLSQHVIQTSLGGYQSVDELL
IPGGRIYEQREFITNTVNDIPGLTAVKPDAGLYIFPKIDRNMYDIDDDEEFCLRLLKKEK
VLLVPGKGFNWNEPDHFRIVYLPRVEELADLGNKIERVLLYYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttgataaatcatcaaagttggaacacgttgcctatgatattcgtggtcca
gttttggatgaggccaaccgtatgattgccaaaggtgaaaaaattctccgtctgaacaca
ggaaatcctgcggaatttggttttacagcaccagatgaagtcattcgtgacttaattatg
aatgttcgtaacagtgaggggtattcagatagtaaggggattttctcagctcgtaaggct
attatgcagtattgccagcttaagggtttcccaaatgtagacatcgatgatatctatatt
ggtaacggtgtgtcagagatgattcccatgtctatgcaggccttgcttgatgatggtgat
gaagtcttggttccaatgccagactatcctctttggacagcttgtgtcagtctagctggc
ggtaacgctgttcactatgtctgtgatgaaaaatctaactggtatccagacattgatgat
atcaaatcaaagattacatcaaatactaaggctattgttattatcaatccgaataacccg
acaggtgctctttaccctaaagatgttcttgaacagattgtcgatattgcacgccaaaat
gatttgattatctttgcggatgagatttatgaccgcttggttatggatggtaagaagcac
attgctattgcaagtcttgcaccagacgttttctgtgtatctatgaatggtctttctaaa
tctcaccgtatttgtggtttccgtgtaggttggatggttctttctgggcctaagaagaat
gttcggggctatattgaagggcttgatatgttgtccaatatgcgcctttgctctaatgtg
ctctctcaacacgtaattcagacctcacttgggggctaccaatctgttgatgagctcctg
attccaggtggtcgtatttatgaacaacgtgagtttattacaaacacagtaaacgatatt
ccaggactcacagctgttaagccagatgcgggtctttacatcttccctaagattgaccgc
aacatgtatgatattgacgatgatgaagagttctgtcttcgtcttttgaagaaggaaaag
gtcctcttggttccaggtaaaggctttaactggaatgaaccggaccacttccgtattgtc
taccttcctcgtgtggaagaattggctgatcttggaaataaaatcgagcgtgttttgtta
tattataagcgctaa

DBGET integrated database retrieval system