KEGG   Streptococcus thermophilus LMG 18311: stu1711Help
Entry
stu1711           CDS       T00213                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00330  Arginine and proline metabolism
stl00332  Carbapenem biosynthesis
stl01100  Metabolic pathways
stl01130  Biosynthesis of antibiotics
stl01230  Biosynthesis of amino acids
Module
stl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    stu1711 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    stu1711 (proB)
Enzymes [BR:stl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     stu1711 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AAV61310
UniProt: Q5M2U0
Position
complement(1516586..1517389)
Genome map
AA seq 267 aa AA seqDB search
MKRNFDSVKRLVIKIGTSSLVLPSGKINLEKIDQLAFVISSLHNKGIEVVLVSSGAMGFG
LNVLDLETRPAEVGKQQAVSSVGQVAMMSLYSQVFSHYQTKVSQLLLTRDVVEYPESLAN
AINAFESLFELGVVPIVNENDAVSVDEMDHATKFGDNDRLSAIVAKVVGADLLIMLSDID
GLFDKNPNVYEDATLRSYVPEITEEILASAGAAGSKFGTGGMMSKIKSAQMVFENQSQMV
LMNGENPRDILRVLEGAKIGTLFKQED
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaattttgactcagtaaaacgcctagttatcaaaatcgggaccagctccttg
gttttgccatcagggaaaattaatcttgaaaaaatcgatcagctagcttttgtgatttct
agcttacacaataaagggattgaggttgtcctcgtatcctctggtgctatgggatttggt
cttaatgttctagatcttgagacgcgtccagcagaggtaggtaagcaacaggctgtctca
agtgtagggcaggtggccatgatgagcctttattctcaagtcttttcacattaccaaacc
aaggtatctcagcttcttttgacccgtgatgtggtcgagtaccccgagagtttggccaat
gccatcaatgccttcgaaagcctctttgagcttggagtagttccaattgttaatgaaaat
gatgctgtcagtgtagatgaaatggatcatgcaactaagtttggggacaatgaccgcttg
tcagctatcgtagctaaggttgttggtgcggacttacttatcatgttgtcagatattgat
gggctctttgataagaacccaaatgtctatgaggatgcaacccttcgtagctatgtacca
gagattaccgaggaaattctagcctcagctggtgctgctggtagtaaatttggtacgggt
ggtatgatgagtaaaattaagtcagctcagatggtttttgaaaatcaaagccaaatggtt
ttaatgaatggtgaaaatccacgtgacattcttcgtgtcctagaaggagccaaaatcggt
acactttttaaacaggaggactaa

DBGET integrated database retrieval system