KEGG   Streptococcus thermophilus LMG18311: stu1767Help
Entry
stu1767           CDS       T00213                                 

Gene name
recD
Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:stl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    stu1767 (recD)
Enzymes [BR:stl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     stu1767 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1576578..1579082
Genome map
AA seq 834 aa AA seqDB search
MQEFYFSGTIERIIFENASNFFRILLLEIDETDSDFEDYEIIVTGTMGDVMEGEDYTFWG
QLTNHPKYGKQLQMTRYERSKPSASGLIKYFSSDNFKGIGKKTAERIVEIYGEDPIDKIL
EDPSKLEQIPNLSKVNREAFLAKLKINYGTEQILSKLSSYGLTPKAASQIFNQYKEESLN
LIEKYPYLLVEEVQGIGFKMADQLAERLGIASDAPERLRAALIHCLLEASMEEGDTYIEA
KSLLERTIILLESSRQIELDPALVAHQLTNLIQEDKVQNIETKIFDNTLYFAEQGIYTHL
TRITKDQPDISAEDKIQASLERVEDELGITYDKVQKDAIIKALQSKVFILTGGPGTGKTT
VINGIIKTYADLHGLDLKKSDLPIILAAPTGRAARRMNELTKLPSATIHRHLGLNGEDDF
KTLDDYLDCDLIIIDEFSMVDTWLANQLFESISDTTQVIIVGDQDQLPSVGPGQVLADLL
QIDDLPKVSLTKIFRQSEDSTIVTLASQIRQGQLPTDFTEKKADRSYFEANANHIPQMVP
KIVSAAIKSGIAAQDVQILAPMYRGQAGINNLNTIMQDLLNPKEKANQFAFNDIFFRKND
KILHLVNDTELNVFNGDIGIITDLIPGKYTESKQDEIYMSFDGNEVIYPRNEWNKITLAY
AMSIHKSQGSEFPVVILPITRQSGRMLQRNLIYTAITRAKSKLVMLGEIAAFDYAVHNEG
AKRNTYLIQRFEQTYTQAVDKSVEKNVKNEGTDAFNQTKTENNRPSETLENKDFSENINP
SQTLINTYSHPVDKSVNKPVQTEENYRLTEENWATIDPMIGLSEDDIAAFFNNN
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaattttatttttcaggaactatcgagcgcatcatttttgaaaatgccagtaat
ttttttcgtatcctactcttagaaattgatgaaactgacagtgattttgaagactatgaa
atcattgttactggaactatgggggatgtcatggagggggaagactataccttctggggt
cagctaaccaatcaccccaaatatggcaaacaactccaaatgactcgctacgagcgttca
aaaccctctgccagtggccttatcaaatatttctccagtgataatttcaaaggaatcggt
aagaaaacggccgagcgtattgtcgagatttatggcgaagaccctattgacaagattctc
gaagaccctagtaaattagagcagattcctaatctgtccaaggtaaaccgagaagccttc
cttgcaaaattaaaaatcaactatggtactgaacaaatcttgtccaaactttccagctat
ggactcacaccaaaggctgcctcacaaattttcaaccaatataaggaagaatcacttaac
cttatcgaaaaatatccttatctcttggtagaggaagtccagggaattggatttaaaatg
gccgatcaactagccgaacgcctagggattgctagcgatgctcctgagcgtttacgagcc
gccctaattcactgtctgctagaagctagtatggaagaaggggacacctacatcgaagcc
aagtccttgcttgaacggactatcattcttttggaaagttctcgccagattgaacttgac
cctgccttggttgctcaccaattgaccaacctcatccaagaggataaggtgcaaaatata
gagactaaaatttttgataataccctatattttgcagaacagggcatctatacccaccta
actcgtatcacgaaagaccagcctgacatcagtgctgaggacaaaatccaagcaagtctt
gaaagggtggaagatgagcttggtatcacctatgacaaggttcaaaaagatgccattatt
aaagccctacaaagcaaggtcttcatcctgacaggtggtcccggaacaggaaaaaccact
gttattaacggaattattaaaacctatgctgaccttcatggtttagacctcaaaaagtct
gatttacccattattttagcagcgccaacgggacgggctgctcgtcggatgaacgaactg
accaagcttcctagtgccactatccatagacatttggggcttaatggcgaggacgatttc
aagaccttagatgactatcttgattgcgatttgattatcatcgatgagttctctatggtt
gatacttggttggccaatcaactcttcgaaagcatttccgatactactcaagtaatcatt
gtaggtgaccaagatcagctaccttctgtaggccctggccaagtcttagctgaccttttg
cagattgatgacttgcctaaggtttccctaaccaaaattttcagacaatctgaggattcc
actattgttaccttagctagccagatacgccaaggccaactacccactgatttcacagag
aaaaaagctgaccgatcatactttgaggctaatgctaaccatattccacagatggtccct
aaaattgtctctgccgctattaaaagtgggatcgctgctcaggatgtacagattctggcc
cccatgtaccggggacaggctggtatcaacaatctcaataccattatgcaggatctactt
aatcccaaagaaaaagccaatcaatttgcctttaatgatattttcttccgtaagaatgac
aagattctccacctggtcaacgatacagaactcaatgtcttcaatggcgatatcggaatc
attactgatctcatacctggtaaatatactgaaagtaagcaagacgaaatttacatgtcc
ttcgatggcaatgaggttatctatcctcgtaacgaatggaataagattactctggcctat
gccatgtctatacacaaatcccaagggagtgaattcccagtcgttatccttcccatcaca
cgccaaagtgggcgtatgcttcaacgtaacctcatctacactgctatcacacgcgccaag
agtaaactggtcatgttgggggaaatcgcagccttcgattatgccgttcacaacgagggg
gccaaacgtaatacctacctcatccaacgttttgaacaaacttatacacaagctgttgat
aagtctgtcgaaaagaatgttaaaaacgagggaacagacgccttcaatcaaacaaaaacg
gaaaacaatagaccctcagaaacccttgaaaacaaagacttctcggaaaatatcaatcca
tcccaaactcttattaacacttattcacatcctgtggataagtctgttaacaaacctgtg
caaacagaagaaaactatcgtttaactgaagaaaactgggcaactatcgacccaatgata
ggtctcagcgaagacgatattgcagccttttttaacaacaactag

DBGET integrated database retrieval system