KEGG   Streptococcus thermophilus LMG18311: stu1833Help
Entry
stu1833           CDS       T00213                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    stu1833 (galU)
   00052 Galactose metabolism
    stu1833 (galU)
   00500 Starch and sucrose metabolism
    stu1833 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    stu1833 (galU)
Enzymes [BR:stl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     stu1833 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1636188..1637102
Genome map
AA seq 304 aa AA seqDB search
MKNQKVRKAVIPAGGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTG
KSKRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTSINLHFIRQSHPRGLGDAVLQAKA
FVGNEPFVVMLGDDLMDITNDKAVPLTKQLINDYEETHASTIAVMPVSSEEVSAYGVIAP
QGKGENGRYSVETFVEKPNPEDAPSDLAIIGRYLLTPEIFGILENQEPGAGNEVQLTDAI
DTLNKTQRVFARVFTGDRYDVGDKFGFMKTSIDYALKHPQIKDDLKQYLIELGHKLEGKP
TKKG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaaagttagaaaagctgtcatccccgctggaggacttggaacacgcttt
ttaccagctactaaagcattggccaaagaaatgttgccaatcgttgacaaaccaaccatc
caatttatcgttgaagaagctcttaagtctggtattgaagatatcttggttgttacaggt
aaatcaaaacgctctatcgaagaccattttgactcaaacttcgaattagaatataacttg
gaacaaaaaggtaagactgacttgttgaaattggttaatgacaccacttctattaatctc
cactttatccgtcaaagtcacccacgtggtctcggagatgctgttctccaagccaaagca
tttgtcggaaatgaaccttttgttgtcatgcttggtgacgacctcatggatattactaac
gacaaagcggtacctttgactaaacaacttatcaacgattatgaggagacacatgcatct
actattgcggttatgcctgtatcttctgaagaagtctctgcttatggtgtaatcgctcct
cagggtaaaggcgaaaatggacgttacagcgttgaaactttcgttgaaaaaccaaatcca
gaagatgcaccgagtgatcttgctatcatcggacgttaccttttaacacctgagattttc
ggtatcttagaaaatcaagaaccaggtgctgggaatgaagtccaattgactgatgctatc
gatactcttaacaaaacacaacgcgtctttgctcgtgtatttacaggagatcgttatgat
gtcggtgacaaatttggctttatgaagacgtctattgattacgcacttaaacaccctcaa
attaaagatgaccttaagcaataccttattgaattgggccacaaacttgaaggcaaaccc
actaaaaaaggctaa

DBGET integrated database retrieval system