KEGG   Streptococcus thermophilus LMG18311: stu1878Help
Entry
stu1878           CDS       T00213                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    stu1878 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    stu1878 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    stu1878 (thrC)
Enzymes [BR:stl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     stu1878 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1680461..1681945)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDENNKVTASQAILQGLATDGGLFTPLTTPEVTLDFDHLKDASYQEVAKLVL
SAFLDDFTEEELDYCITNAYDDKFDTATIAPVVKLQNHYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGVDNKIVILTATSGDTGKAAMAGFADVPETEIIVFYPKDGVSKIQELQMT
TQAGANTHVIAIDGNFDDAQTNVKRMFNDVDLREKLLTHHMQFSSANSMNIGRLVPQVVY
YVYAYAQLVKAGHIKNGDKVNFTVPTGNFGNILAAYYAGQIGVPVGKIICASNENNVLTD
FFATGTYDKKRDFKVTTSPSMDILVSSNLERLIFHLLGNDAVKTKELMDALVTKGEYTLA
DADKGILDLFAAGFATEDETAAEIKRVYEEDKYIEDPHTAVASTVYEAYVQKTDDHTPTV
IASTASPYKFPRVAVSAVTGKDSGDDFKAVEDLHQLSGVDIPAAVDGLERAEVRHKTVVA
AADMQKAVESYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtataccaatcaacacgtgacgaaaacaataaagtaacagctagtcaggct
attcttcaaggattggcaacagatggtggcttgttcactccactgacaacacctgaagtt
actttagactttgatcacttgaaagatgcttcttaccaagaagttgctaaattagttttg
tctgctttcttggatgattttactgaagaagaattggattactgtatcacaaatgcttat
gatgataagtttgatacagctaccattgctccagtggtcaaacttcaaaaccattacaac
cttgagctttttcatggttctaccattgctttcaaagatatggcgctttcaatattgccc
tatttgctaacaacatcagctaagaaacaaggtgttgataacaagattgttattttgaca
gcgacatcaggggatactggtaaagctgccatggctggttttgcagatgtccctgaaact
gaaattattgtcttttatccaaaagatggcgtttcaaaaatccaagaattgcaaatgaca
actcaagcaggtgctaatactcatgttattgcaattgatggtaactttgatgatgcccaa
acaaatgtgaaacgtatgtttaacgatgttgatttgcgtgagaaattgttgactcatcat
atgcaattctcatcagctaactcaatgaacattggtcgtttggtaccacaagtggtttac
tatgtgtatgcctatgcgcagttggtgaaggcaggtcatatcaaaaatggggataaggtt
aacttcacagtaccaacaggaaactttggtaacatcttggcggcttactatgcaggtcaa
attggtgttccagttggtaaaataatctgtgcttctaacgaaaataatgtccttacagac
ttctttgcaacaggtacttatgacaagaaacgtgacttcaaggtaacgacaagtccttct
atggacattttggtatcttctaacctagaacgcttgattttccatctccttggtaatgat
gcggttaagactaaagagcttatggatgcgcttgtgactaaaggtgagtacactttggct
gatgcagataaaggtatccttgatttgtttgcagcgggatttgcaactgaggatgaaaca
gctgctgaaatcaaacgtgtttatgaagaagacaagtatattgaagatcctcacacagcg
gttgcctcaactgtttacgaagcatacgttcaaaagacagatgatcacacaccaacagtt
atcgcttcaacagctagtccatacaagttcccacgtgtagcggtttcagctgttactggt
aaagatagtggtgatgacttcaaggcggtagaagacttgcaccaactttcaggagtagat
atcccagctgctgtagatggacttgaacgtgcagaagttcgccataaaacagtagttgct
gcagctgatatgcagaaagcagttgagagctatcttggtgtataa

DBGET integrated database retrieval system