KEGG   Streptococcus thermophilus LMG18311: stu1882Help
Entry
stu1882           CDS       T00213                                 

Definition
alcohol-acetaldehyde dehydrogenase, truncated
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stl  Streptococcus thermophilus LMG18311
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    stu1882
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    stu1882
   00620 Pyruvate metabolism
    stu1882
   00650 Butanoate metabolism
    stu1882
  Lipid metabolism
   00071 Fatty acid degradation
    stu1882
  Amino acid metabolism
   00350 Tyrosine metabolism
    stu1882
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    stu1882
   00626 Naphthalene degradation
    stu1882
Enzymes [BR:stl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     stu1882
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     stu1882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1683598..1684158)
Genome map
AA seq 186 aa AA seqDB search
MILAEIPDATMEHPLALEKLSPVLALIKSDGVEDGFKKAEGMLNLGGIGHTAVIHTENEE
LQLQYGIRMKACRVLVNSPSAEGGIGNIYNNMIPSLTLGCGSHGHNSILHNVSSFDLLNV
KTLSKRRNNMQWFRVPTKIFFEKDSITYLRHIEADRVMLVCDPGMVQFGYADLVKRNWNL
TAIDQQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgattttggcagaaattccagatgcaacaatggaacacccacttgccttggaaaaattg
tctccagtacttgcccttatcaaatctgatggcgttgaagatggattcaaaaaagcagaa
ggcatgctcaatttgggaggtattggacatacagctgttattcacactgaaaatgaagag
ctccaactccaatacggtatccgtatgaaagcttgccgtgtcttggtgaatagtccatcg
gctgaaggtggcattggtaatatctataacaacatgattccatcattaactcttggttgt
ggttcacacggtcataactcaattttacacaatgttagctcatttgatctcttgaatgtc
aagacattgtcaaagcgtcgcaataacatgcaatggtttcgtgtcccaacaaaaatcttc
ttcgaaaaagattcaataacttacttgcgtcacattgaagctgaccgggtgatgttggtt
tgtgaccctggtatggttcagtttggttacgctgacttggttaaacgcaattggaactta
accgccatagaccagcagtag

DBGET integrated database retrieval system