KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3714Help
Entry
STM3714           CDS       T00065                                 

Gene name
rfaK
Definition
hexose transferase (EC:2.4.1.56)
Orthology
K03280  
UDP-N-acetylglucosamine:(glucosyl)LPS alpha-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.56]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, inner core => outer core => O-antigen
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:stm00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3909561..3910706)
Genome map
AA seq 381 aa AA seqDB search
MIKKIIFTVTPIFSIPPRGAAAVETWIYQVAKRLSIPNAIACIKNAGYPEYNKINDNCDI
HYIGFSKVYKRLFQKWTRLDPLPYSQRILNIRDKVTTQEDSVIVIHNSMKLYRQIRERNP
NAKLVMHMHNAFEPELPDNDAKIIVPSQFLKAFYEERLPAAAVSIVPNGFCAETYKRNPQ
DNLRQQLNIAEDATVLLYAGRISPDKGILLLLQAFKQLRTLRSNIKLVVVGDPYASRKGE
KAEYQKKVLDAAKEIGTDCIMAGGQSPDQMHNFYHIADLVIVPSQVEEAFCMVAVEAMAA
GKAVLASKKGGISEFVLDGITGYHLAEPMSSDSIINDINRALADKERHQIAEKAKSLVFS
KYSWENVAQRFEEQMKNWFDK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcatatttactgttactcctatattttcaattcctcctcgtggtgcg
gctgcggtagaaacctggatttaccaggttgcaaaacgactatcaataccgaatgctatt
gcttgtataaagaatgctggctatcctgaatataataaaataaacgataactgtgatatt
cattacatcgggtttagtaaagtttataagcgtctttttcagaaatggactcgtctcgac
ccactaccctattcccagcgcatccttaatattagagataaagtgactacccaggaagat
agcgtcattgttattcataatagtatgaaactgtatcggcagatcagagagcgcaatccg
aatgcaaaactggttatgcacatgcataatgcatttgaaccagaacttcctgataatgat
gcaaaaattatcgtgcccagtcagtttcttaaagcgttttatgaagaaagattgcccgcc
gctgctgttagtattgtgcctaatggtttttgtgctgagacttataaaagaaacccacaa
gataatcttcgtcagcaattaaatattgcggaagatgccaccgttctcttgtatgccggg
agaatttcgcctgataaaggcatcctgttgcttttgcaggcgttcaaacaattacgtacc
ttaagaagtaatattaaacttgtcgttgttggcgacccttatgcaagccgcaagggtgaa
aaagcagagtatcaaaagaaagtactggacgccgcaaaagagattggaacggattgtatt
atggctggggggcaatctcctgaccagatgcataacttctatcatatagccgatctggtt
attgtgccatctcaggttgaagaagcattttgcatggtggctgtagaagcgatggcagca
ggaaaagcggttcttgccagcaaaaaaggggggattagcgaatttgtgttagatggcata
acgggctatcacctcgcagaacctatgtcgagcgacagtataattaatgatattaaccgt
gcgcttgctgataaggaacgccaccagattgccgaaaaagcaaaatccctggtgttttca
aaatacagttgggaaaatgtagcgcagcgtttcgaggaacaaatgaaaaactggtttgat
aagtga

DBGET integrated database retrieval system