KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3717Help
Entry
STM3717           CDS       T00065                                 

Gene name
rfaJ
Definition
lipopolysaccharide 1,2-glucosyltransferase (EC:2.4.1.58)
Orthology
K03279  
UDP-glucose:(galactosyl)LPS alpha-1,2-glucosyltransferase [EC:2.4.1.58]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, inner core => outer core => O-antigen
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    STM3717 (rfaJ)
Enzymes [BR:stm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.58  lipopolysaccharide glucosyltransferase I
     STM3717 (rfaJ)
Glycosyltransferases [BR:stm01003]
 Polysaccharide
  Bacterial polysaccharide
   STM3717 (rfaJ)
Lipopolysaccharide biosynthesis proteins [BR:stm01005]
 Core region
  STM3717 (rfaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3912487..3913497)
Genome map
AA seq 336 aa AA seqDB search
MDSFPEIEIAEYKVFDESNNNDDNVLNISYGVDENYLDGVGVSIASVVLNNNIPLAFHII
CDSYSPCFVKYIERLAVQHHIKISLYLIKVESLEVLPQTKVWSRAMYFRLFAFDYLSKKV
NTLLYLDADVVCKGSLQDLLQLDLTEKIAAVVKDVDSIQNKVNERLSAFNLQGGYFNSGV
VFVNLKLWKENALTKKAFLLLAGKEADSFKYPDQDVLNILLQDKVIFLPRPYNTIYTIKS
ELKDKSHKKYSNIINDNTILIHYTGATKPWHAWANYPSVIYYKNARLNSPWKDFPAKDAR
TIVEFKKRYKHLLVQGHYFKGLLAGSAYLYRKLFHK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggattcatttcctgagatagaaatagctgaatataaagtttttgatgaaagtaataat
aatgatgataacgtattaaacatttcttatggcgttgatgaaaactatcttgatggtgtg
ggggtatcaatcgcttcagttgtattaaacaataatatcccgctcgcttttcacattatt
tgtgactcatactccccgtgttttgtaaaatatatagagcgtttagccgtacagcatcac
ataaaaatttctctttatcttattaaagtagaaagccttgaggtattgcctcaaactaaa
gtatggtcgagagcaatgtattttcgtttatttgctttcgattatctcagcaagaaggta
aataccttactttatttggatgccgatgttgtatgcaaaggatctttgcaagatctttta
cagcttgatctgacagagaagatcgctgcggtcgtaaaagatgttgattccatccagaat
aaggtaaatgagagattaagcgcttttaatttacaaggtggttattttaactccggcgtg
gtttttgttaacctgaaattatggaaagagaatgccttaaccaaaaaggcatttttactt
ttggcaggtaaagaggctgactcttttaaatatcccgatcaggatgttttgaatattctc
ctacaggataaagtcatttttctaccgcgaccgtataatactatttatactattaaaagt
gagttgaaagataagtcacataaaaaatatagcaatataattaatgataatactatttta
attcattatacgggcgctacaaaaccatggcatgcctgggcaaattatccttcagttatc
tattataaaaatgcacgactgaactcgccctggaaagattttcccgcaaaagatgcgcgt
accatagtcgaatttaagaagcgatataaacatcttctcgtgcaaggtcattattttaaa
ggccttctggctggaagcgcatatctttatcgtaaacttttccacaaataa

DBGET integrated database retrieval system