KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM0358.SHelp
Entry
STM0358.S         CDS       T00065                                 

Gene name
res
Definition
type III restriction-modification system DNA helicase
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
Enzymes [BR:stm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     STM0358.S (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
405296..408271
Genome map
AA seq 991 aa AA seqDB search
MMMNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERYDDKANIDVKMETGT
GKTYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYARQHFSQFYENTRMELC
TINAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLNSASMTRDDYDQTLLG
GLTSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVRFGATFPDIVEGKGKNK
CVRKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANNRYIVDSVTAKKLILRRG
SKIAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMALVPGTFGASYQELIIQDA
IDKHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRDDEGWLKVTFERLLKKKLTQ
LIDDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFGEDRGSGDEAIQAEVDDILKN
KEKLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIAKLRSSGSESSKIQEVGRGLRL
PVDENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDEINRDSKVQLNEQKLDEAMITLIVT
ERQKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTLNGETKSGFAWLLEFYPELTQARVR
ADRIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRYMLQFERSGASLEQIAAEVLRDPAL
YIRQKPSQVQQRLVSNEDNGRFEVAQREGELAASEFMAGMKYGHFLKQLALRTSLPVNVL
HPVLMAMLRDVLHGDSRYLSEISLDNMTRALQTRINAHFAQRHDYLPLDFQASTSVFDST
ARQFREEISAEIVGKNVDENAIDDPRSLYQIPPLRYDSVDPELPLLKYDYPQQVSVFGKL
PKRAIQIPKYTGGSTTPDFVYRIERQDADSVYLLVETKAENMRVGDQVILDAQRKFFDML
RRQNINVEFAEATSAPAVFSTINGLIEGKAN
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaatattttactggaagaacttccccatcaggaacaggcgttagcggcgatt
ctggcgagtttcaccggtatcgatcacgcgcaagccgatcataatcactatgctaatccg
ctgattaaggaacgttacgacgataaggccaatattgacgttaaaatggagaccgggacg
ggtaaaacctatgtctatacccggttgatgtatgaattgcatcagaagtatggcctcttc
aaatttgtgctggtggtgccgacgccagccattaaagaaggcgcgcggaactttattacc
agcgattacgccagacagcatttttcacagttctacgaaaatacgcggatggaactttgc
accatcaacgccggtgattttaaagtaaagtcggggcgtaaaaattttccggcccagcta
ttaagttttactgatgccagccgtcgtgatagccatacgattcaggttttgctgatcaat
gcgcaaatgctcaattccgccagtatgacgcgagacgattacgatcaaacgctcctgggc
gggctgacgtcgcctgttaaagggctgcaaatgacgcgaccggtggtcattattgatgaa
ccgcatcgttttgcgcgagataacaaattttatcgagcgattcaggctattcagccgcaa
atgatcgtccgctttggcgctaccttcccggatattgtcgaaggtaagggtaaaaataaa
tgtgtacgtaaagattactatcgccggcaaccgcagtttgatctcaacgcggtggacagt
tttaacgatggtttggtgaaaggtattgatatttattacccgaatctccccgaagaacag
gccaacaatcgttatatcgttgacagcgtcacggcaaagaaattaatcctccgacggggg
agcaaaattgccgaggttggcgtgggcgaaaatctcgccgatgtcgatgcaggatttgaa
ggcagtatcgaatatgccggcagtaaaatgttgtcgaacgatctggagctggaggcaggg
atggcgctggtgccaggaacctttggcgcgagctaccaggaactgattattcaggacgct
atcgataagcattttgacactgagcaggcaaatttcttacgcagcaatgagccagaaaat
aatgccccgcgtattaagaccttaagccttttctttattgacagtattaaaagctatcgt
gatgacgaaggctggttgaaagtcacttttgagcgtttgctgaaaaagaaactgacgcaa
ctgattgacgattatcagcgcaagaccctgccgcgagaagtggagtatctgtcgtttctg
caggccacgctcgccagcctgcactcggataaccaaaacgtccacgctggttactttggc
gaagaccgcggaagcggtgatgaggcgatccaggctgaggtagatgatattctgaaaaat
aaagagaagttgctcagtttttcagaccatcacggcaactgggaaacgcgccgctttctg
ttttcaaaatggacgcttcgcgaaggctgggataacccgaatgtttttgtcattgctaaa
ttacgttcttccggtagcgagtcgagcaaaattcaggaagtggggcgcggcctgcggcta
ccggtagatgaaaatggtcatcgcgttcatcaggaagagtggccgtcccgactgtcgttt
ctgattggttatgatgaaaaagcgtttgccagtatgctggttgatgagattaatcgcgac
agcaaagttcagcttaacgagcagaagctggatgaggcgatgatcacactcatcgtcacc
gagcgacaaaaagtcgatcctgcgtttacggagcttcgtttgctggaagatctggatgat
aaaaaactgatcaaccggagcaatgagtttaaacccagcgtcacgcttaacggggaaacc
aaaagtggttttgcgtggctactggagttctaccctgagctgacgcaggcgcgggtgcga
gcggatcgcattcgtgacaataagcccgcctcccggctgcgagtcaggttacgcaaagag
aattgggaacaacttagcagtatctgggagcagttttcccgccgttatatgctgcaattc
gagcgtagcggcgcttctctggaacaaattgccgccgaggtgctgcgcgatccggcgctg
tatattcgccagaagccaagccaggtgcaacaacggctggtatcgaatgaagataatggc
cgttttgaagtggcgcagcgggaaggcgaattagccgccagcgaatttatggcgggcatg
aaatatggccattttcttaagcaactggcgttacgcaccagtctgccggttaacgtcctg
cacccggtgttaatggcgatgctgcgtgatgttttgcacggagattcacgctatttaagc
gagatctcgttggacaatatgacccgcgcattacagacgcggattaatgcgcattttgcg
cagcgccacgattatctgcctctcgattttcaggcttcaacgtcggtatttgattccacg
gcacggcagttcagagaggagattagcgctgaaattgtggggaaaaatgtggatgagaat
gcgatagacgatccccgttctctctatcaaataccgccgttgcgttatgacagcgtcgat
ccagaattgccgctattaaaatacgattatccgcaacaggtttctgtgtttggcaaactg
cctaagcgggccattcagatccccaaatatacggggggctctactacgccggattttgtg
taccgtattgagcgtcaggacgccgacagcgtttatttactggttgaaactaaagcagaa
aatatgcgcgtaggcgatcaggttattcttgatgcgcaacgtaaattcttcgatatgctg
cgtcggcaaaatatcaatgtcgagtttgcggaagcgaccagcgcgccggcggtattttct
acgatcaatggcttgattgaggggaaggcaaactaa

DBGET integrated database retrieval system