KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM0738Help
Entry
STM0738           CDS       T00065                                 

Gene name
sucC
Definition
(RefSeq) succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00020  Citrate cycle (TCA cycle)
stm00640  Propanoate metabolism
stm00660  C5-Branched dibasic acid metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01120  Microbial metabolism in diverse environments
stm01130  Biosynthesis of antibiotics
stm01200  Carbon metabolism
Module
stm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
stm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STM0738 (sucC)
   00640 Propanoate metabolism
    STM0738 (sucC)
   00660 C5-Branched dibasic acid metabolism
    STM0738 (sucC)
Enzymes [BR:stm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     STM0738 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 1252258
NCBI-ProteinID: NP_459723
UniProt: P66869
Position
805914..807080
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIGKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccggcgccg
gtgggttatgcctgtactactccgcgtgaagccgaagaagccgcgtctaaaatcggcgct
ggcccgtgggtagtgaaatgtcaggttcacgctggcggccgcggcaaagcgggcggtgtg
aaggtagtaaaaagcaaagaagagattcgcgccttcgcggaaaactggctgggcaaacgt
ctggtgacctatcaaacagacgctaatggccaaccggtaaaccagattctggttgaagcg
gcgaccgacatcggcaaagaactgtacctcggcgcggtagttgaccgtagttctcgtcgc
gtggtctttatggcgtctaccgaaggtggcgtagagatcgaaaaagtcgcggaggaaacc
ccgcatctgatccataaagtcgcgctcgatccgctgaccggcccgatgccgtatcaggga
cgggaactggcgttcaaattgggtctggaaggtaaactggtgcagcagttcaccaaaatc
tttatgggtctggcaaccattttccttgagcgcgacctggcgctgatcgaaatcaacccg
ctggtgattactaagcagggcgatctgatttgcctcgacggcaagctgggcgctgacggc
aacgcgctgttccgccagccggatctgcgtgaaatgcgtgaccagtctcaggaagacccg
cgtgaagcgcaggcagcgcagtgggaactgaactacgtcgcgctggacggcaacatcggt
tgcatggtgaacggcgcgggtctggcgatgggcaccatggacatcgttaagctgcatggc
ggcgaaccggctaacttccttgacgtgggcggcggcgcaaccaaagagcgcgtcaccgaa
gcgtttaaaattatcctctcggatgacaacgtgaaagcggttctggttaacatcttcggc
ggtatcgtccgttgtgacctgattgccgacggtatcatcggcgcggtggaagaagtgggc
gtgaacgttccggtggtggtgcgtctggaaggcaacaacgccgaactcggcgcgaagaaa
ctggctgacagtggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system