KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1525Help
Entry
STM1525           CDS       T00065                                 

Gene name
yneH
Definition
(RefSeq) putative glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00220  Arginine biosynthesis
stm00250  Alanine, aspartate and glutamate metabolism
stm00471  D-Glutamine and D-glutamate metabolism
stm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STM1525 (yneH)
   00220 Arginine biosynthesis
    STM1525 (yneH)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    STM1525 (yneH)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     STM1525 (yneH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 1253043
NCBI-ProteinID: NP_460485
UniProt: Q8ZPI2
Position
1602637..1603563
Genome map
AA seq 308 aa AA seqDB search
MARAMDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHE
RFSIQSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRALCGVSDITYDATVARSEFEHSARNAAIAWLMKSFGN
FHHDVPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLT
QTLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggccagggccatggataatgcaattttagagacgattttacagcgcgttcgccccctc
attggccagggcaaagtcgctgactatattccggcattagcgtccgtcgaaggttcaaag
ctggggatagcgatttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaa
cgcttctctattcagtctatttcgaaagtgctcagtctggtggtggcgatgcgtcattat
ccggaagaggagatctggcagcgcgtcggaaaagatccttccggctcgccgttcaattcg
ttggttcagttagagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcg
ctggtggtatgcgacatgttgcaaggccggcttagcgcgccgcgtcagcggatgctggaa
gttgtgcgcgcgctttgcggcgtatcggatattacgtatgacgctacggtcgcgcgctct
gaatttgagcattccgcccgtaacgccgctattgcctggctgatgaaatcattcggtaat
tttcatcatgatgtgcctaccgtgttgcaaaattactttcactactgtgcgttgaaaatg
agctgcatggaactggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcat
ctcgacgagccggtagtgacccccatgcaggcccggcagattaatgcgctaatggcgacc
agcgggatgtatcagaatgccggcgagtttgcctggcgggtgggattgcccgctaaatcc
ggcgtgggcggcggtattgtcgccatagtgccgcatgaaatggcgattgccgtctggagt
ccggagctggatcctgcgggaaactctctggcaggtatcgccgcgcttgagcaattaaca
caaacgttaggacgttcggtatactga

DBGET integrated database retrieval system