KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1525Help
Entry
STM1525           CDS       T00065                                 

Gene name
yneH
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:stm00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:stm00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:stm00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1602644..1603570
Genome map
AA seq 308 aa AA seqDB search
MARAMDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHE
RFSIQSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRALCGVSDITYDATVARSEFEHSARNAAIAWLMKSFGN
FHHDVPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLT
QTLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggccagggccatggataatgcaattttagagacgattttacagcgcgttcgccccctc
attggccagggcaaagtcgctgactatattccggcattagcgtccgtcgaaggttcaaag
ctggggatagcgatttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaa
cgcttctctattcagtctatttcgaaagtgctcagtctggtggtggcgatgcgtcattat
ccggaagaggagatctggcagcgcgtcggaaaagatccttccggctcgccgttcaattcg
ttggttcagttagagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcg
ctggtggtatgcgacatgttgcaaggccggcttagcgcgccgcgtcagcggatgctggaa
gttgtgcgcgcgctttgcggcgtatcggatattacgtatgacgctacggtcgcgcgctct
gaatttgagcattccgcccgtaacgccgctattgcctggctgatgaaatcattcggtaat
tttcatcatgatgtgcctaccgtgttgcaaaattactttcactactgtgcgttgaaaatg
agctgcatggaactggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcat
ctcgacgagccggtagtgacccccatgcaggcccggcagattaatgcgctaatggcgacc
agcgggatgtatcagaatgccggcgagtttgcctggcgggtgggattgcccgctaaatcc
ggcgtgggcggcggtattgtcgccatagtgccgcatgaaatggcgattgccgtctggagt
ccggagctggatcctgcgggaaactctctggcaggtatcgccgcgcttgagcaattaaca
caaacgttaggacgttcggtatactga

DBGET integrated database retrieval system