KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1567Help
Entry
STM1567           CDS       T00065                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STM1567 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STM1567 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    STM1567 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    STM1567 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STM1567 (adhP)
   00626 Naphthalene degradation
    STM1567 (adhP)
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STM1567 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1647794..1648804
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVDVTEKTLRPLRHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEE
CIVVADYAVKVPEGLDSAAASSITCAGVTTYKAVKISHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLKLAEEMGADLTINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMNLDIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLEDINVIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgtcacacaagatcatcaggttgatgttactgagaaaacgctgcgt
ccccttcgccacggtgaagctttgctaaaaatggagtgctgcggcgtatgccataccgat
ctacacgtgaaaaacggcgatttcggtgacaaaaccggcgttattctgggacacgaaggc
attggcgtcgtggcggaagtcggtcctggtgtcacctcgctgaaacccggcgatcgcgcg
agtgtcgcgtggttttatgaaggatgcggacactgtgagtattgcaatacgggcaatgaa
accttatgccgcaacgtgaaaaatgccggttacacggtagatggcggtatggccgaagag
tgtattgtcgtcgcggattatgcggtgaaagtaccggaaggtctggactctgcagcggca
agtagtattacctgcgcgggcgttaccacctataaagcggtgaagatttctcatattaaa
cctggccagtggattgccatctacggtctgggcggtctgggtaatctggccttgcagtac
gcgaaaaacgttttcaatgcgaaagtgatcgccattgatgtcaatgatggacaactgaaa
ctggccgaggaaatgggcgcagatctgaccattaattcacgtacggaagatgcggctaaa
attgtgcaggaaaaaaccggtggcgcgcacgcagcggtggttaccgcggtcgctaaggcg
gcgtttaattccgcagtagatgccgttcgcgccggaggccgcgtggtggcagtcgggttg
ccgccagaagccatgaaccttgatatccctcgcctggtgctggatggcattcaggttgtc
ggttcgttggtggggacacgccaggatctgaccgaagccttccagtttgcggcggaagga
aaagtcgtgccaaaagtcgctttacgtccgcttgaagatatcaacgttatttttaaagag
atggaacagggacaaattcgtggccgtatggtcatcgatttccgtcgttaa

DBGET integrated database retrieval system