KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1726Help
Entry
STM1726           CDS       T00065                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00260  Glycine, serine and threonine metabolism
stm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01130  Biosynthesis of antibiotics
stm01230  Biosynthesis of amino acids
Module
stm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STM1726 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STM1726 (trpB)
Enzymes [BR:stm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STM1726 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 1253245
NCBI-ProteinID: NP_460685
UniProt: P0A2K1
Structure
PDB: 

Jmol
Position
1823073..1824266
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALT
KCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGM
FADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSI
SAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALK
MMREQPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacttctcaacccctactttggtgaattcggcggcatgtatgtgccgcagatc
ctgatgcctgcgctgaaccagcttgaagaggccttcgtcagcgcgcaaaaagatcctgaa
tttcaggcgcaattcgccgatctgctaaaaaactacgcgggacgccccaccgcgctgacg
aaatgccagaacattaccgccggtacgcgtaccacgttgtatttaaagcgcgaagattta
ctgcacggcggcgcgcacaaaaccaatcaggtactgggtcaggcgctgctggccaaacgg
atgggtaaaagcgagattatcgctgaaaccggcgccggtcagcacggcgtcgcctctgcg
ctcgccagcgccctgctgggtctgaaatgccgtatctatatgggcgccaaagacgttgag
cgccagtcgccgaacgtcttccgtatgcgtctgatgggcgctgaggtcatcccggttcat
agcggctccgctacgctaaaagatgcctgtaacgaggcgctgcgcgactggtccggtagt
tacgaaaccgcgcactatatgctcggcacggcggcaggaccgcatccctatcccaccatc
gttcgcgagttccagcgcatgattggcgaagagacgaaagcgcaaatcctcgacaaagag
ggccgtctgccagatgccgttatcgcttgcgtcggtggcggctcaaacgctatcgggatg
tttgccgattttattaatgataccagcgtcgggctaataggcgttgaacctggtggtcat
ggtattgaaaccggcgagcatggcgcgccgcttaaacatggtcgcgttggcatctatttc
gggatgaaagcgccgatgatgcaaacagcagacgggcaaattgaagagtcctattccatt
tccgccgggctcgatttcccgtccgttgggccgcaacatgcgtacctgaacagcatcgga
cgcgcggattatgtctccattaccgatgatgaggcgctggaagccttcaaaacgttgtgc
cgccatgagggaattatcccggcgctggagtcctcccacgcgttggcgcacgctctgaaa
atgatgcgcgagcagccggaaaaagagcaactgctggtggtcaatctctctggccgcgga
gataaagacatctttaccgtacacgatatcctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system